Identifiers and Description

Gene Model Identifier

TTHERM_00497880

Standard Name

RPL3 (Ribosomal Protein of the Large subunit )

Aliases

PreTt06953 | 62.m00237 | ribosomal protein L3 | 3715.m00098

Description

Ribosomal protein L3; highly expressed large (60S) ribosomal subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.6%

TetraMine Data

TTHERM_00497880

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_350970
Tetrahymena borealisEI9_12683.19.997093137033517e-262ribosomal protein L3 containin
g protein (392 aa)
DictyBaseDDB_G02918629.998061997456677e-175rpl3 on chromosome: 6 position
954736 to 956486
WormBaseWBGene000044144.998065322133077e-171locus:rpl-3 60S ribosomal pr
otein L3 status:Confirmed
UniProt:P50880 protein_id:CA
A90183.1
OxytrichaContig15450.0.g411.0001999920370885e-161Ribosomal protein L3
SGDYOR063W6.997785648757479e-148RPL3 Protein component of the
large (60S) ribosomal subunit,
has similarity to E. coli L3
and rat L3 ribosomal proteins;
involved in the replication a
nd maintenance of killer doubl
e stranded RNA virus

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8
  2. Ref:10704239: Larsen LK, Andreasen PH, Dreisig H, Palm L, Nielsen H, Engberg J, Kristiansen K (1999) Cloning and characterization of the gene encoding the highly expressed ribosomal protein l3 of the ciliated protozoan Tetrahymena thermophila. Evidence for differential codon usage in highly expressed genes. Cell biology international 23(8):551-60

Sequences

>TTHERM_00497880(coding)
ATGTCTCACAGAAAATTCGAAGCCCCCAGACACGGCTCCCTCGGTTTCAGACCCAGAAGA
AGAACAAGACATCACAGAGGTAGATGCAGATCTTTCCCTAAGGATGATCCCTCCAAGAAG
CCCCACTTGACCGCTTTCACTGGTTTCAAGGCTGGTATGACCCATATCTTGAGAGAAGTC
GACAGATCTGGTTCCAGACACAACAAGAAGGAAGTTGTTGAAGCCGTTACCGTCATCGAA
TGTCCCCCCATGACCATCGTCGGTGTCGTCGGTTACATTGATACCCCCAGAGGTCTCAGA
GCTTTGACCACCGTCTGGGCTAAGACCATCGATAACAACACCAAGAAGAGATTCTACAAG
AACTGGGCTAACTCTAACAAGAAGGCTTTCACTCATCACGAAAAGAACTTCGACCAAAAG
GCTCAAGATCTCCTCTTAAAGAGAATCGAAAAGTACTGCTCTGTCGTCAGAGTTATTGCT
CACACCAACATGAGCAAGCTCAACCTTAGACAAAAGAAGAACCACATCCTCGAAATCTAA
GTTAACGGTGGTAAGGTTGCTGAAAAGGTTGCTTTCGCCAAGAGCTTATTAGAAAAGGAA
GTTAAGGTTGACTCCATCTTCGCTGAAAACGAAATGCTCGACGTTTTGGGTGTTACCAAG
GGTAAGGGTTTCGCTGGTGTCATCAAGAGATTCGGTGTTAAGCATTTACAAAAGAAGACC
CATAGAGGTTACAGAAAGGTCGGTTGTATCGGTGCATGGCATCCTTCCAGAATCAGATTC
ACTGTCCCCAGAGCTGGTCAATTGGGTTATCACCACAGAACCGAAACCAACAAGAAGGTT
TACAGAGTCGGTAAGGGTGATGATGCTTCCAATGCTTCCACTGCTGGTGATGTCACTGAT
AAGGCTATCACTCCTTTGGGTGGTTTCCCCCACTATGGTGTCGTCAAGAACGATTTCATC
ATGATCAAGGGTTGCTGCGTTGGTCCCAAGAAGAGAGTTCTTACTTTAAGAAAGTCCATT
ATTCCTCAAACCCACGGTGCTGCTAAGGAAATCATCAACCTTAAGTTCATCGATACCTCT
TCCAAGATTGGTCACGGTAGATTCCAAACTGTCGAAGAAAAGGACAAATTCTTCGGTAGA
GACAGAACCAAAAAGGTCGAAGCCAAGAGCGAATGA


>TTHERM_00497880(protein)
MSHRKFEAPRHGSLGFRPRRRTRHHRGRCRSFPKDDPSKKPHLTAFTGFKAGMTHILREV
DRSGSRHNKKEVVEAVTVIECPPMTIVGVVGYIDTPRGLRALTTVWAKTIDNNTKKRFYK
NWANSNKKAFTHHEKNFDQKAQDLLLKRIEKYCSVVRVIAHTNMSKLNLRQKKNHILEIQ
VNGGKVAEKVAFAKSLLEKEVKVDSIFAENEMLDVLGVTKGKGFAGVIKRFGVKHLQKKT
HRGYRKVGCIGAWHPSRIRFTVPRAGQLGYHHRTETNKKVYRVGKGDDASNASTAGDVTD
KAITPLGGFPHYGVVKNDFIMIKGCCVGPKKRVLTLRKSIIPQTHGAAKEIINLKFIDTS
SKIGHGRFQTVEEKDKFFGRDRTKKVEAKSE


>TTHERM_00497880(gene)
ATGTCTCACAGAAAATTCGAAGCCCCCAGACACGGCTCCCTCGGTTTCAGACCCAGAAGA
AGAACAAGACATCACAGAGGTAGATGCAGATCTTTCCCTAAGGATGATCCCTCCAAGAAG
CCCCACTTGACCGCTTTCACTGGTTTCAAGGCTGGTATGACCCATATCTTGAGAGAAGTC
GACAGATCTGGTTCCAGACACAACAAGAAGGAAGTTGTTGAAGCCGTTACCGTCATCGAA
TGTCCCCCCATGACCATCGTCGGTGTCGTCGGTTACATTGATACCCCCAGAGGTCTCAGA
GCTTTGACCACCGTCTGGGCTAAGACCATCGATAACAACACCAAGAAGAGATTCTACAAG
AACTGGGCTAACTCTAACAAGAAGGCTTTCACTCATCACGAAAAGAACTTCGACCAAAAG
GCTCAAGATCTCCTCTTAAAGAGAATCGAAAAGTACTGCTCTGTCGTCAGAGTTATTGCT
CACACCAACATGAGCAAGCTCAACCTTAGACAAAAGAAGAACCACATCCTCGAAATCTAA
GTTAACGGTGGTAAGGTTGCTGAAAAGGTAATTAATTAAATTTTGAGTTAAATAAATATT
AAACTACTCGTGTAAGATGAATGAAATTTTTCTTAACTAGCTGCTAAAAAAATCTAAAAG
ATAGCAAATTTTAGTATTAAAGTTTTCTATATAATCATAAGTGAATAAACAAAGCATTAC
ATGCCAATTATACAAAAGTGAAAGATTAAAAAGCAACTGTAAATGCCTAGTCATATTTTA
GAAGCTAAAATAGTGATCTAAGTAAAGATTAAATTAAGGGATAAAGAAAATTTTATATTG
GGAAGTATTATAATCTCTTTAAGCATATAAGCAGAGCTGAATAACAAAATATTTGATGAA
AACAGCATTAATAGAAATAAACCAGTTAAATTGATAAGGAAAAAACAAATATCCCGATCA
ACAAATAGAATATTTAAAATGTTCGATGCAAATTCTCTTAAATATTATCAATGAAATATA
ATTTTGTGAAGAAAAATAAATTATTCGTTTAAAGAATATATTTAGAAATATGAAAAAATA
AAAATACTTTAGTATGAAATAATAAATGGCTAGATTTAGATTATTAAAAATAATTTTAGT
TAGTTAGTTAATTAGTTTATTAATAAATTAATTATTCATCTTCATGAGTGCATTTGATAA
TTTTGAATCAGCTTGATTGATGTTAATTTTATTTTGAATTAATAAAAAGGTTGCTTTCGC
CAAGAGCTTATTAGAAAAGGAAGTTAAGGTTGACTCCATCTTCGCTGAAAACGAAATGCT
CGACGTTTTGGGTGTTACCAAGGGTAAGGGTTTCGCTGGTGTCATCAAGAGATTCGGTGT
TAAGCATTTACAAAAGAAGACCCATAGAGGTTACAGAAAGGTCGGTTGTATCGGTGCATG
GCATCCTTCCAGAATCAGATTCACTGTCCCCAGAGCTGGTCAATTGGGTTATCACCACAG
AACCGAAACCAACAAGAAGGTTTACAGAGTCGGTAAGGGTGATGATGCTTCCAATGCTTC
CACTGCTGGTGATGTCACTGATAAGGCTATCACTCCTTTGGGTGGTTTCCCCCACTATGG
TGTCGTCAAGAACGATTTCATCATGATCAAGGGTTGCTGCGTTGGTCCCAAGAAGAGAGT
TCTTACTTTAAGAAAGTCCATTATTCCTCAAACCCACGGTGCTGCTAAGGAAATCATCAA
CCTTAAGTTCATCGATACCTCTTCCAAGATTGGTCACGGTAGATTCCAAACTGTCGAAGA
AAAGGACAAATTCTTCGGTAGAGACAGAACCAAAAAGGTCGAAGCCAAGAGCGAATGA