Identifiers and Description

Gene Model Identifier

TTHERM_00488340

Standard Name

RPL29 (Ribosomal Protein of the Large subunit )

Aliases

PreTt08337 | 60.m00134

Description

Ribosomal protein L29; subunit of the large (60S) ribosome that confers cycloheximide resistance when mutated

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00488340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13522.17.99705442073232e-89ribosomal protein L15 containi
ng protein (150 aa)
OxytrichaContig15154.0.g201.9999167998962255e-60Ribosomal protein L18e/L15
WormBaseWBGene000213509.002663577881587e-59status:Confirmed UniProt:Q9B
KU5 protein_id:CCD73428.1
DictyBaseDDB_G02923885.001636743996964e-56rpl27a on chromosome: 6 positi
on 1592145 to 1592902
SGDYGL103W3.998181939598921e-51RPL28 Ribosomal protein of the
large (60S) ribosomal subunit
, has similarity to E. coli L1
5 and rat L27a ribosomal prote
ins; may have peptidyl transfe
rase activity; can mutate to c
ycloheximide resistance
Stentor CoeruleusSteCoe_243183.532628572200807e-24

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:7828881: Jahn CL, Erbeznik M, Jaraczewski JW, Melek M, Shippen DE (1994) Sequence of the macronuclear DNA encoding large subunit ribosomal protein 29 (L29) in Euplotes crassus and cycloheximide sensitivity. Gene 151(1-2):231-5
  2. Ref:1409625: Gaertig J, Gorovsky MA (1992) Efficient mass transformation of Tetrahymena thermophila by electroporation of conjugants. Proceedings of the National Academy of Sciences of the United States of America 89(19):9196-200
  3. Ref:1946363: Yao MC, Yao CH (1991) Transformation of Tetrahymena to cycloheximide resistance with a ribosomal protein gene through sequence replacement. Proceedings of the National Academy of Sciences of the United States of America 88(21):9493-7

Sequences

>TTHERM_00488340(coding)
ATGACTATTTAAAATAAGAATGGGCTAAAAAAGAAAAATAAAATAAGATGCTTTGAGGAG
GAAATTCAATATAATTTTTGGGAGTGCGAAAATATAGACGGGTAGAGGCAAATTAATTAG
AAAGAGGAGAGATTAAAAGGCTAAAAGATATAAAAACAATTTTTAAAGGCAAAAAATAAA
TTAATCAAAACAAAGACATATATATAGTAAATAAAAATGGTATCTCACTTAAAGAAGACT
AGAAAGTTGAGAGGTCACGTCTCTCACGGTCACGGTAGAGTCGGAAAGCACAGAAAGGGT
GGTTGCAGAGGTGGTCGTGGTAAGGCCGGTGGTATGCATCATCACAGAATCTTGATGGAA
AAGTGGCATCCTGGCTACTACGGAAAGTTGGGTATGAGAACCTTCCACTTAAAGAAGAAC
CCTCTCCACTGCCCCGTTGTTAATATCGACAAGCTCTGGAGTTTGGTTTCTGATGCTACC
AGACAAAAGTACGCTGAAGATAAGAAGAAGGTCCCCGTTATTGATGTTACCAAGGCTGGT
TTCTTCAAGGTTTTGGGTAAGGGTAGACTCCCCAACCAACCTGTCGTTGTTAAGGCTAAA
TACTTCTCCAAGACTGCTGAAAGAAGAATCGTCGCTGTCGGTGGTGCTTGCGTCCTCACT
GCTTGA


>TTHERM_00488340(protein)
MTIQNKNGLKKKNKIRCFEEEIQYNFWECENIDGQRQINQKEERLKGQKIQKQFLKAKNK
LIKTKTYIQQIKMVSHLKKTRKLRGHVSHGHGRVGKHRKGGCRGGRGKAGGMHHHRILME
KWHPGYYGKLGMRTFHLKKNPLHCPVVNIDKLWSLVSDATRQKYAEDKKKVPVIDVTKAG
FFKVLGKGRLPNQPVVVKAKYFSKTAERRIVAVGGACVLTA


>TTHERM_00488340(gene)
ATGACTATTTAAAATAAGAATGGGCTAAAAAAGAAAAATAAAATAAGATGCTTTGAGGAG
GAAATTCAATATAATTTTTGGGAGTGCGAAAATATAGACGGGTAGAGGCAAATTAATTAG
AAAGAGGAGAGATTAAAAGGCTAAAAGATATAAAAACAATTTTTAAAGGCAAAAAATAAA
TTAATCAAAACAAAGACATATATATAGTAAATAAAAATGGTATCTCACTTAAAGAAGACT
AGAAAGTTGAGAGGTCACGTCTCTCACGGTCACGGTAGAGTCGGAAAGCGTAATTAAAAA
TCCACTATCATCTTATTCATCATTTAATCTCAATCCATCTCATGGGATTCTTCTTTCAGT
CCATCTTCGATTCGCTTCGTTCGTACAAAAATCATGATTTGATTTTTTCATAAAAATAAA
TCAATCTGTTAAAGAGCGAGCAAGATGGTTCAAAGCATCCTTTAATGCAATCAAACGTTA
CTTTATCTTTCGAAAAACTAAATAATCTAGGACTTAAGCTCAGTCCCGCTAATGAAACAA
CTAACTAGGTCGTTCCAAAATAGAAAAATAAGAAAGAAAAAATAGATTTAGTAATTTAAA
GCATGCATTATTGTAGATAGTTAGCTTGAAGGGAGACAAAGTCAACCCTCAAGCTAATTT
TGAAGGAGGACATGAGATAAGGGATTAGAGAAAACAAACAACTAAATAAACAAAATTATT
AATACAATTTCATTCTAAAATATAGACAGAAAGGGTGGTTGCAGAGGTGGTCGTGGTAAG
GCCGGTGGTATGCATCATCACAGAGTAATTATTTCTTTCTTAATTTTTTTTCAATCAGTT
TAATCGAATTCTACTTCGCTTTTGCATACTGTTTGAAAGCTCAATTAGTTTGCAAGCAAG
AGTGAGTAGAATTGGAGATAACTTTATTTCTTTGATTTATCTATCTAGTCACCAATATTG
ATAAATTTATTTTAATTAAATAGATCTTGATGGAAAAGTGGCATCCTGGTATGATATCAA
ATTAAATACAAATATTCATATATAAAAAAGCAAATTTAATACTTCTTTATAAGGGAATTT
AGTTTATAACAGCATCTTAAATATAACAACAAAAGCAATTTATTTATTCATCCATTGCTT
AACTACTTTTCAGAAAAACCAAAACAATAGAGCAAAGATTATTTCTATCAACAAATTTTT
GTTCAATTTACAATTGAAAAATTGCAGCTAAAAATAAGAAATTTAAAATAAGTAAAATTT
TCTTGATAGTAATTAACTTAAAAGTTCAATGAATCGAATTTTTCACCTGGTTTACTGAAT
GAATCCAAAATTAATTCTATCTGAGCTAGCTCCTCTACACACACAATTTGTTGAAAAGAC
TTATCAAAAAATAATGAATAATTAATTAATTAGCCATCTAGCAAATATTAAGTTCAAATA
AATACCTATGAAGTTTCTAAGTATTTTATTGATAGAATTGAATCAAAGTCATAAATAAAT
CAAAGGATATAAACAAATTAACAGATAGATATGCTTATAAATACGAGAAGTAATGATAAA
CAGTATTGCTTATTTTTGATTAGAGAAAGATCATATATATTCAATAAGATTGAATGAATA
ATTTCTTCCTTACTTACTGTTAAGCTGAAAAGAGTTTAGAATAAATAAATAGAAAGCATT
TTTGTTAAATTTGAACGATGCTGCTACTTAAGCAAATTCCTTTTTATAAAATTTTAAAAC
GATGTTATTTTAATATAAAAACTAATATATTTTTTGTTTTGATTAGGCTACTACGGAAAG
TTGGGTATGAGAACCTTCCACTTAAAGAAGAACCCTCTCCACTGCCCCGTTGTTAATATC
GACAAGCTCTGGAGTTTGGTTTCTGATGCTACCAGACAAAAGTACGCTGAAGATAAGAAG
AAGGTCCCCGTTATTGATGTTACCAAGGCTGGTTTCTTCAAGGTTTTGGGTAAGGGTAGA
CTCCCCAACCAACCTGTCGTTGTTAAGGCTAAATACTTCTCCAAGACTGCTGAAAGAAGA
ATCGTCGCTGTCGGTGGTGCTTGCGTCCTCACTGCTTGA