Identifiers and Description

Gene Model Identifier

TTHERM_00780960

Standard Name

RPL27 (Ribosomal Protein of the Large subunit #27)

Aliases

PreTt01308 | 130.m00118 | 3738.m00054

Description

Homolog of Yeast RPL27, Human RPL27; Alias RPL27e

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 21%

TetraMine Data

TTHERM_00780960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18688.15.998946283774988e-95hypothetical protein (175 aa)
OxytrichaContig10169.0.g999.996696112986116e-50Ribosomal L27e protein family
SGDYDR471W4.997755005759707e-41RPL27B Protein component of th
e large (60S) ribosomal subuni
t, nearly identical to Rpl27Ap
and has similarity to rat L27
ribosomal protein
WormBaseWBGene000044418.997017754360629e-34locus:rpl-27 60S ribosomal p
rotein L27 status:Confirmed
UniProt:P91914 protein_id:
CCD67946.1
DictyBaseDDB_G02712989.99723014177113e-33rpl27 on chromosome: 2 positio
n 140424 to 141268
Stentor CoeruleusSteCoe_356521.5628821893349888e-18

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00780960(coding)
ATGGCCAAATTCCTCAAGTACGGTAGAGTTGTCATCCTTTTACAAGGTAGATTCGCTGGT
AAGAAGGCTGTCATCGTCAAGTCCTCTGAAGATGGTACCAAGGACAGAAAGTTCGGTCAC
GTCTTAGTTGCTGGTGTTGAAAGATCCCCCAAGAAGGTCACCAAGAGAATGGGTTCCAAG
AAGATCTAAAAGAGAACTTCCGTCAAGCCCTTCATTAAATACGTCAACCTTAACCATATC
ATGCCCACCAGATACTCCGTTAAGGAACTCTGTGACTTCAAGGAACTTGTTAAGGAAGAT
AAGATCAAGAACAACGCTAAGTCTGAAGTTAGAGACACCTTAAAGAAGGTCTTCGTCGAA
AAGTACAGAACCATCAACCCCGAAGAAAAGAGCGCTTCTCACACTAAATTCTTCTTCTCC
AAGCTTAGATTCTGA


>TTHERM_00780960(protein)
MAKFLKYGRVVILLQGRFAGKKAVIVKSSEDGTKDRKFGHVLVAGVERSPKKVTKRMGSK
KIQKRTSVKPFIKYVNLNHIMPTRYSVKELCDFKELVKEDKIKNNAKSEVRDTLKKVFVE
KYRTINPEEKSASHTKFFFSKLRF


>TTHERM_00780960(gene)
ATGGCCAAATTGTAATAAATATTATTCAGTAGATGTCTTTTTGATTTACAATATTTTTAT
TAATTAATATAGCCTCAAGTACGGTAGAGTTGTCATCCTTTTACAAGGTAGATTCGCTGG
TAAGAAGGCTGTCATCGTCAAGTCCTCTGAAGATGGTACCAAGGTATGTATTTAAAGATT
CTACAATTTCAGAAACTTAGATTATTACAAATGATGTTTTAAAGAAATTAAATTTGCTCC
TCTTTAATTAAGACAAATTAAGCAAATAAGCGAATTTTTGAAAGAAAAAAAAAACTACTT
TTATGGAATTTTCATTAAGTTAATTTTAAAATTGGCATCCAAAAATTTATTTGCTTTCAT
TTTCAGACAATGAAAAGTATCTTTTAGCCTTTCACTTTTAAGGCTGATATTATCAAATTT
ACTGAGGAACAAAAATGTGTTTATCAATAAATTGATCTAATATTCAAAATTTAATCAACA
GGACAGAAAGTTCGGTCACGTCTTAGTTGCTGGTGTTGAAAGATCCCCCAAGAAGGTCAC
CAAGAGAATGGGTTCCAAGAAGATCTAAAAGAGAACTTCCGTCAAGCCCTTCATTAAATA
CGTCAACCTTAACCATATCATGCCCACCAGGTAATTAATTAATTATCTATATTAAGAAAA
GATGGATTACAGATTAGACATTCTTTTAGCTAAATTTAGTAATACAGTTATTAGAGGGTA
AATAAATAAGATAGGAGAATTGAAAATTATTAACTGCAATATGGGTAAAGTAAGATATGT
GAAAAAGGAATAAAAAAGATTGTGAAAACTACCTAAAATAAATATATAACTAAAAGAAGA
AGCATTTGTGTTAATTAGGCTTGAACAAAATAAATATTAGTAAATTAAAATGAATATAAT
ATATAAAGTAGAAAGCCTTAATTAAGTAGGACCACTAAAATTAATTACAGATATATATTG
CATGAACTTAGGGGTTTAAATAAATCTTTCTTTTGAATTCATTAAAATGAATTAAAACTG
ACAGGATTTCATTTAGTAGATAAATCTAAAATGACAGAGTCTCAATCAAAATAATAAAAT
TTATCTATTGTTTCAAGTTAAATTAAGAACTTTTAGAGTAGAAGTTCATATAAAAAAATA
AATTAGTGGAAGATTAGCGATAATGTTAATATAAATTTACTTACTTACCTACCTACCTTC
AATCTATCCTATTGGCAATTTAAGATAATTAATTAACTAACCCTTAATAATTATGAGCTG
GAGATCTATAAAATTTTCAGATACTTATTAAGCTAATAAGACAGACTAATTACTGAAAAA
TAAGTTTTTAACGTATTACAAGTTTTAAAGCTAAGAATAGAATTTTTTGAATCCATCATA
TATTTATTTATCATTGATTATGTTGAAGAAATCTTTTATTAAAAAATTTAAATTATTAAA
ATTTAGATACTCCGTTAAGGAACTCTGTGACTTCAAGGAACTTGTTAAGGAAGATAAGAT
CAAGAACAACGCTAAGTCTGAAGTTAGAGACACCTTAAAGAAGGTCTTCGTCGAAAAGTA
CAGAACCATCAACCCCGAAGAAAAGAGCGCTTCTCACACTAAATTCTTCTTCTCCAAGCT
TAGATTCTGA