Identifiers and Description

Gene Model Identifier

TTHERM_00382350

Standard Name

RPL26 (Ribosomal Protein of the Large Subunit #26)

Aliases

PreTt10392 | 40.m00277

Description

RPL26 60S ribosomal protein L26; Homolog of Yeast RPL26- Human RPL26- Bacteria RPL24

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00382350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00028.16.000414531663983e-92hypothetical protein (136 aa)
OxytrichaContig16644.0.g578.996537154595168e-51KOW motif
SGDYGR034W2.999884853455273e-42RPL26B Protein component of th
e large (60S) ribosomal subuni
t, nearly identical to Rpl26Ap
and has similarity to E. coli
L24 and rat L26 ribosomal pro
teins; binds to 5.8S rRNA
DictyBaseDDB_G02837414.001118334825066e-42rpl26 on chromosome: 4 positio
n 1048980 to 1049683
WormBaseWBGene000044407.000550667562452e-41locus:rpl-26 60S ribosomal p
rotein L26 status:Confirmed
UniProt:Q19869 protein_id:
CAA92674.1
Stentor CoeruleusSteCoe_212022.1151310375910805e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00382350(coding)
ATGGGACGGACACGAGAACCAATGATCAACCCATCAGCCAGAGAGTTTATTTATTCGCAA
GCGACATACACGCTTTAAGTTTCATCTGCTAGAAGAAAATAAAGAAAGGCTCATTTCGCC
TCTCCCTCTCACCTCAGACAAACCTTGATGTCTGCTCACCTTTCCAAGGATCTCAGATCT
AAGTACAACGTTAGATCCATGCCCGTTAGAAAGGACGACGAAGTTCTTATTGTTAGAGGT
AAATTCAAAGGTAACAAGGGTAAGGTTACTCAAGTCTACAGAAAGAAATGGGCTATCCAC
GTTGAAAAGATCTCCAAGAACAAACTCAACGGTGCTCCTTACCAAATCCCCTTATCTGCT
TCCCAATTAGTCCTCACTAAGTTGAAGCTTGATAAGAGTAGACAATCCCTCCTCACCAGA
AAGGCTGCTTCCCTTAAGACCAAGGGTCAAAAGCACACTGTTGCTTGA


>TTHERM_00382350(protein)
MGRTREPMINPSAREFIYSQATYTLQVSSARRKQRKAHFASPSHLRQTLMSAHLSKDLRS
KYNVRSMPVRKDDEVLIVRGKFKGNKGKVTQVYRKKWAIHVEKISKNKLNGAPYQIPLSA
SQLVLTKLKLDKSRQSLLTRKAASLKTKGQKHTVA


>TTHERM_00382350(gene)
ATGAAAACCCACGTCGGTATACATTTAATATTTTTATAATAATTCTACTGAATGCTGGAC
ATCCTTAAATGGGACGGACACGAGAACCAATGATCAACCCATCAGCCAGAGAGTTTATTT
ATTCGCAAGCGACATACACGCTTTGTAAAATGAAGGCTGCGTCGCAAAAATTTTGCAATC
AAGCATTTAAATGCATTCGATTTTTAATACAATCAAAAATTAGATCATGTTCTGTTTGTT
CTTCGTTGTCTCTCTCATTCAACCAAAGAAAAAAGGATGGAAATAATTCAGCAAATTAGA
TAATGAAAGCATTTAATTAACTAAATTTTTTATTATTACAGAAGTTTCATCTGCTAGAAG
AAAATAAAGAAAGGCTCATTTCGCCTCTCCCTCTCACCTCAGACAAACCTTGATGTCTGC
TCACCTTTCCAAGGATCTCAGATCTAAGTACAACGTTAGATCCATGCCCGTTAGAAAGGA
CGACGAAGTTCTTATTGTTAGAGGTAAAAACCGAATTCAAATAGCACAATTTCTGTTTTA
TTTTAGAAATAGTTTTATGGAAAGTAGGATTTGATTAGATAAAGCATCAATCTATCAAAT
AAACAAATTCTCTTTCTTATTCATTAGATTTCAGTCCTATGCTTCTGATGATCTTATCTA
AACTATTTTTTAATTAAAAAGGTAAATTCAAAGGTAACAAGGGTAAGGTTACTCAAGTCT
ACAGAAAGAAATGGGCTATCCACGTTGAAAAGATCTCCAAGAACAAACTCAACGGTAATT
TTTTAACCAAATATCAACTTTTAACTAGCTTTTAGCCAAATAAACTATATACCAAATGAA
TAACAAGACTAAATAATATGTAGAAATCTTATGTGTTAGGTTATAACAATATACTTCTCC
TTAAATTTTAAGAATTTTCGGTTCAATTTAGGAAATATTTAGTAATTAACTATCAAAGGC
AACTCAGCAATTTAGCTAAATTAAATATAATAAGTCAGTCAGTCATTCAGCTAATTAGTC
TCTCATCCATCAATCCTTCAAGTTTATAATTCATTTCAGTAAACTAAACTAAACTAAAAT
TACATTCTCTATTAACATCTTAAGCAAATTAGTTGAAATTCATTAGCAAATTAAAAGCAA
AAGAGGTGTAAGTAAGTAACAAAAAAAACCAAAACCAAACTAGAATAAAAATATACAAGA
CACATTTATCTAAAATGCAATCGGCTAAATTAATTTATGAAAAATTTCTATCAACCAGCA
TGCATGTATGTGCATTAATTTATCAAAAATGAATAATAAATAATTTATCAAAGCACTTAA
ATTTGCATCTAAATTCAGATACTTTTAACAAAAGTTACTATATTTGATTCTTTGCTATTT
TGATAGCTTTGCAAAATCTACTATGAGTTTTTGTTCAAATATTCAAATTATCTCAGGGAA
AAACAGAACGAACAAAACAAAATAATAAATAAATGAATTATGTAATTAACTACTACTTAC
TTAATAAATAAAAGCATAAATTAATAAATGAATTAATCAACCTAATTGAATTAGTAAACT
TTGATTGATTGATTGATTGATTGATTGATGATTAAGAGCTAGCTCTCTAAATTGGTCTTT
GAATGGCTTAAAATCGAAAGGAGAAGTTATAATAAGAATTTATATTATTTAGTTGTTTGT
TAATGGGATATATGGTTATCATCTCATAATAAGCCTTATTTATGTTTTAGTAATAATTTG
TTGTATTTAAAATTAGGTGCTCCTTACCAAATCCCCTTATCTGCTTCCCAATTAGTCCTC
ACTAAGTTGAAGCTTGATAAGAGTAGACAATCCCTCCTCACCAGAAAGGCTGCTTCCCTT
AAGACCAAGGGTCAAAAGCACACTGTTGCTTGA