Identifiers and Description

Gene Model Identifier

TTHERM_00382350

Standard Name

RPL26 (Ribosomal Protein of the Large Subunit #26)

Aliases

PreTt10392 | 40.m00277

Description

Homolog of Yeast RPL26, Human RPL26, Bacteria RPL24

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00382350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00028.16.000414531663983e-92hypothetical protein (136 aa)
OxytrichaContig16644.0.g578.996537154595168e-51KOW motif
SGDYGR034W2.999884853455273e-42RPL26B Protein component of th
e large (60S) ribosomal subuni
t, nearly identical to Rpl26Ap
and has similarity to E. coli
L24 and rat L26 ribosomal pro
teins; binds to 5.8S rRNA
DictyBaseDDB_G02837414.001118334825066e-42rpl26 on chromosome: 4 positio
n 1048980 to 1049683
WormBaseWBGene000044407.000550667562452e-41locus:rpl-26 60S ribosomal p
rotein L26 status:Confirmed
UniProt:Q19869 protein_id:
CAA92674.1
Stentor CoeruleusSteCoe_212022.1151310375910805e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00382350(coding)
ATGAAAACCCACGTCGAAGTTTCATCTGCTAGAAGAAAATAAAGAAAGGCTCATTTCGCC
TCTCCCTCTCACCTCAGACAAACCTTGATGTCTGCTCACCTTTCCAAGGATCTCAGATCT
AAGTACAACGTTAGATCCATGCCCGTTAGAAAGGACGACGAAGTTCTTATTGTTAGAGGT
AAATTCAAAGGTAACAAGGGTAAGGTTACTCAAGTCTACAGAAAGAAATGGGCTATCCAC
GTTGAAAAGATCTCCAAGAACAAACTCAACGGTGCTCCTTACCAAATCCCCTTATCTGCT
TCCCAATTAGTCCTCACTAAGTTGAAGCTTGATAAGAGTAGACAATCCCTCCTCACCAGA
AAGGCTGCTTCCCTTAAGACCAAGGGTCAAAAGCACACTGTTGCTTGA


>TTHERM_00382350(protein)
MKTHVEVSSARRKQRKAHFASPSHLRQTLMSAHLSKDLRSKYNVRSMPVRKDDEVLIVRG
KFKGNKGKVTQVYRKKWAIHVEKISKNKLNGAPYQIPLSASQLVLTKLKLDKSRQSLLTR
KAASLKTKGQKHTVA


>TTHERM_00382350(gene)
ATGAAAACCCACGTCGGTATACATTTAATATTTTTATAATAATTCTACTGAATGCTGGAC
ATCCTTAAATGGGACGGACACGAGAACCAATGATCAACCCATCAGCCAGAGAGTTTATTT
ATTCGCAAGCGACATACACGCTTTGTAAAATGAAGGCTGCGTCGCAAAAATTTTGCAATC
AAGCATTTAAATGCATTCGATTTTTAATACAATCAAAAATTAGATCATGTTCTGTTTGTT
CTTCGTTGTCTCTCTCATTCAACCAAAGAAAAAAGGATGGAAATAATTCAGCAAATTAGA
TAATGAAAGCATTTAATTAACTAAATTTTTTATTATTACAGAAGTTTCATCTGCTAGAAG
AAAATAAAGAAAGGCTCATTTCGCCTCTCCCTCTCACCTCAGACAAACCTTGATGTCTGC
TCACCTTTCCAAGGATCTCAGATCTAAGTACAACGTTAGATCCATGCCCGTTAGAAAGGA
CGACGAAGTTCTTATTGTTAGAGGTAAAAACCGAATTCAAATAGCACAATTTCTGTTTTA
TTTTAGAAATAGTTTTATGGAAAGTAGGATTTGATTAGATAAAGCATCAATCTATCAAAT
AAACAAATTCTCTTTCTTATTCATTAGATTTCAGTCCTATGCTTCTGATGATCTTATCTA
AACTATTTTTTAATTAAAAAGGTAAATTCAAAGGTAACAAGGGTAAGGTTACTCAAGTCT
ACAGAAAGAAATGGGCTATCCACGTTGAAAAGATCTCCAAGAACAAACTCAACGGTAATT
TTTTAACCAAATATCAACTTTTAACTAGCTTTTAGCCAAATAAACTATATACCAAATGAA
TAACAAGACTAAATAATATGTAGAAATCTTATGTGTTAGGTTATAACAATATACTTCTCC
TTAAATTTTAAGAATTTTCGGTTCAATTTAGGAAATATTTAGTAATTAACTATCAAAGGC
AACTCAGCAATTTAGCTAAATTAAATATAATAAGTCAGTCAGTCATTCAGCTAATTAGTC
TCTCATCCATCAATCCTTCAAGTTTATAATTCATTTCAGTAAACTAAACTAAACTAAAAT
TACATTCTCTATTAACATCTTAAGCAAATTAGTTGAAATTCATTAGCAAATTAAAAGCAA
AAGAGGTGTAAGTAAGTAACAAAAAAAACCAAAACCAAACTAGAATAAAAATATACAAGA
CACATTTATCTAAAATGCAATCGGCTAAATTAATTTATGAAAAATTTCTATCAACCAGCA
TGCATGTATGTGCATTAATTTATCAAAAATGAATAATAAATAATTTATCAAAGCACTTAA
ATTTGCATCTAAATTCAGATACTTTTAACAAAAGTTACTATATTTGATTCTTTGCTATTT
TGATAGCTTTGCAAAATCTACTATGAGTTTTTGTTCAAATATTCAAATTATCTCAGGGAA
AAACAGAACGAACAAAACAAAATAATAAATAAATGAATTATGTAATTAACTACTACTTAC
TTAATAAATAAAAGCATAAATTAATAAATGAATTAATCAACCTAATTGAATTAGTAAACT
TTGATTGATTGATTGATTGATTGATTGATGATTAAGAGCTAGCTCTCTAAATTGGTCTTT
GAATGGCTTAAAATCGAAAGGAGAAGTTATAATAAGAATTTATATTATTTAGTTGTTTGT
TAATGGGATATATGGTTATCATCTCATAATAAGCCTTATTTATGTTTTAGTAATAATTTG
TTGTATTTAAAATTAGGTGCTCCTTACCAAATCCCCTTATCTGCTTCCCAATTAGTCCTC
ACTAAGTTGAAGCTTGATAAGAGTAGACAATCCCTCCTCACCAGAAAGGCTGCTTCCCTT
AAGACCAAGGGTCAAAAGCACACTGTTGCTTGA