Identifiers and Description

Gene Model Identifier

TTHERM_00134940

Standard Name

RPL25 (Ribosomal Protein of the Large subunit #25)

Aliases

PreTt24318 | 10.m00367 | 3698.m00088 | RPL23A

Description

Homolog of Yeast RPL25, Human RPL23A, Bacteria RPL23; Ribosomal protein L23 containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00276 ) ribosomal protein L23
  • ( PF03939 ) Ribosomal protein L23, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00134940

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05760.13.999498296699862e-96ribosomal protein L23 containi
ng protein (151 aa)
OxytrichaContig1434.1.g1232.0003218023735366e-33Ribosomal protein L23
WormBaseWBGene000044396.99868990988981e-32locus:rpl-25.2 60S ribosomal
protein L23a 2 status:Confi
rmed UniProt:Q20647 protei
n_id:CAA99858.1
SGDYOL127W6.002270911168926e-31RPL25 Primary rRNA-binding rib
osomal protein component of th
e large (60S) ribosomal subuni
t, has similarity to E. coli L
23 and rat L23a ribosomal prot
eins; binds to 25S rRNA via a
conserved C-terminal motif
DictyBaseDDB_G02935022.000620012690291e-23rpl23a on chromosome: 6 positi
on 2967908 to 2968721
Stentor CoeruleusSteCoe_300330.000000000000004658886145103398

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00134940(coding)
ATGAACAAGGAAAACAAGACTCAAGCTGTTAACAAGGCCAAGAACACCGCCAAGGTTGCC
AAGAAGGGATCTTCCATCACCAAGCACAAGACCTACACTGGTGTTAGATTCTTCAGACCC
AAAACCTTATAATTAGCTAAGGCTCCCAAGTACTCCAGAACCGTCAGAGCTCACCTTAAG
GTTTCTGGTCACTTAGATAACCACTCTGTCGTCAAGACCCCCTTGACCACTGAAAAGGCC
ATGAAAAAGATGGAAGACGAAAACACTATGGTTTTCTACGTCCACAACAGATCTACCAAG
CCTTAAATTAAGTCTGCTTTCGAAAAGCTCTACAACGTTAAGGTTAGATCCGTCAACACC
CTTAATACTATCACTGGTAACAAGAAGGCCTACATCAGATTAGCTGCTGATTCTGACTCT
CTTACCCTTGCCAACAAGATCGGTCTCATATGA


>TTHERM_00134940(protein)
MNKENKTQAVNKAKNTAKVAKKGSSITKHKTYTGVRFFRPKTLQLAKAPKYSRTVRAHLK
VSGHLDNHSVVKTPLTTEKAMKKMEDENTMVFYVHNRSTKPQIKSAFEKLYNVKVRSVNT
LNTITGNKKAYIRLAADSDSLTLANKIGLI


>TTHERM_00134940(gene)
ATGAACAAGGAAAACAAGACTCAAGCTGTTAACAAGGCCAAGAACACCGCCAAGGTTGCC
AAGAAGGGATCTTCCATCACCAAGCACAAGACCTACACTGGTGTTAGATTCTTCAGACCC
AAAACCTTATAATTAGCTAAGGCTCCCAAGTACTCCAGAACCGTCAGAGCTCACCTTAAG
GTTTCTGGTCACTTAGATAACCACTCTGTCGTCAAGACCCCCTTGACCACTGAAAAGGCC
ATGAAAAAGATGGAAGACGAAAACACTATGGTTTTCTACGTCCACAACAGATCTACCAAG
CCTTAAATTAAGTCTGCTTTCGAAAAGCTCTACAACGTTAAGGTTAGATCCGTCAACACC
CTTAATACTATCACTGGTAACAAGAAGGCCTACATCAGATTAGCTGCTGATTCTGACTCT
CTTACCCTTGCCAACAAGATCGGTCTCATATGA