Identifiers and Description

Gene Model Identifier

TTHERM_00297140

Standard Name

RPL23 (Ribosomal Protein of the Large subunit #23)

Aliases

PreTt15725 | 27.m00385 | 3692.m00187 | RPL14

Description

Homolog of Yeast RPL23, Human RPL23, Bacteria RPL14; Ribosomal protein L14p/L23e containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00297140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08866.11.9995541014149208e-99ribosomal protein L14p/L23e co
ntaining protein (142 aa)
WormBaseWBGene000044355.001369568193564e-73locus:rpl-23 60S ribosomal p
rotein L23 status:Confirmed
UniProt:P48158 protein_id:
CCD61530.1
SGDYER117W2.999277470785175e-69RPL23B Protein component of th
e large (60S) ribosomal subuni
t, identical to Rpl23Ap and ha
s similarity to E. coli L14 an
d rat L23 ribosomal proteins
DictyBaseDDB_G02903152.9995010303521745e-64rpl23 on chromosome: 5 positio
n 3946402 to 3947228
OxytrichaContig861.1.g241.0002758036576784e-62Ribosomal protein L14p/L23e
Stentor CoeruleusSteCoe_347854.359610000063081e-28

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00297140(coding)
ATGGCTGCTGCTAGAGGTAGAGGTGGTTAAGTCGGTACCAAGGCTAAAGTTTCCTTGGGT
CTTCCCGTCGGTGCTGTTATGAACTGCGCTGATAACTCCGGTGCTAAGAACTTATATACT
ATTGCTTGTTTCGGTATCAAGGGTCACTTGAGCAAGCTCCCCAGTGCTTCCATTGGTGAT
ATGATTCTCTGCTCCGTCAAGAAGGGTTCCCCCAAGCTCAGAAAGAAAGTTCTCTAAGCT
ATCGTCATCAGACAAAGAAGACCCTGGAGAAGAAGAGATGGTGTCTTCATCTACTTCGAA
GATAATGCTGGTGTTATTGCTAACCCCAAGGGTGAAATGAAGGGTTCCCAAATCACTGGT
CCCGTCGCCAAGGAATGTGCTGACATCTGGCCCAAGGTTGCTTCCAACGCTGGTTCCGTT
GTTTGA


>TTHERM_00297140(protein)
MAAARGRGGQVGTKAKVSLGLPVGAVMNCADNSGAKNLYTIACFGIKGHLSKLPSASIGD
MILCSVKKGSPKLRKKVLQAIVIRQRRPWRRRDGVFIYFEDNAGVIANPKGEMKGSQITG
PVAKECADIWPKVASNAGSVV


>TTHERM_00297140(gene)
ATGGCTGCTGCTAGAGGTAATTTTAACTTAAATTTGTATTGATCAATTTCACAAATTTTT
CATCCAGCCAGCTCAATGTTTTCGCATCATCATAAAGTCTCATAAAAAATATGGAAGCAC
TAATTGCAGTTAAATGCCTTTATACAAAGCTAAAATTTTCATTAAATTCTACAGATTTAT
AAGGAAATGTCTCTTTGATGCAAATAATAATTTGATGTTAAAATTAATATTTAATATGAA
TTGAGATAAGCAAAAAAAGTGGGCCTGATAAGCTTATGAATTTATATAAAGCGAATAAAA
TGCAGGATATTTAAATTAATTAGATAGATGTGTTGGACTTTGAAAAGTTGGATGAAAAAT
TGAATTTTAGGAGAAGATAAACAAACCATTAATTGATATTGATTAATTTGGTTGTTTTTC
ATAAATACAAAATTTTAAAATATGGATTAATTGAAATTAAATTTAAATTACTTAAATTAT
AGGTAGAGGTGGTTAAGTCGGTACCAAGGCTAAAGTTTCCTTGGGTCTTCCCGTCGGTGC
TGTTATGAACTGCGCTGATAACTCCGGTGCTAAGAACTTATATACTATTGCTTGTTTCGG
TATCAAGGGTCACTTGAGCAAGCTCCCCAGTGCTTCCATTGGTGATATGATTCTCTGCTC
CGTCAAGAAGGGTTCCCCCAAGCTCAGAAAGAAAGGTAAACTATAAAATAACAATTTTTA
AAAACTAATTCTAATTTAATTATTTAACTAATAGTTCTCTAAGCTATCGTCATCAGACAA
AGAAGACCCTGGAGAAGAAGAGATGGTGTCTTCATCTACTTCGAAGGTGAATAATTTTAA
ATATTTTAAATACAAGGCATAAAATGAAAACGAAAAAATCATTAATCCCAATTTATTAAA
AAAGTGATAAGTCTTGCAAAGATGTTATTAAATAATTACAAATATAAAGATGAGTAGATT
AGGCAAAAATAATAAAAATTAAATCATTAGTAATAACTAAATAGAGTATAGTTATCAAAT
CAAAATAAATTAAGCCTTATGTCGTGTTACATAAGAGAAAAATTAGCATTAAAAATAATA
TTGTAGAAAATTTGACAAATGTCACTCACTCACTATCTTCTTATTCAAGACTTTATCAGC
AAATAAATATATTCAAATTTAGCTTCAGAAAATGCTAAGTAGAATTTATAGCATTATTTT
ATTAATTGGTAAAAATAGAATCAATCAATAAATAAATAAATTATTGACTAAATATTTGTT
TATTTTACCAATTTAGAAATAAATAGAGGGATAAATGAATTTTTTCATTTTACATTGAAC
ATCTTTAATATTTTTTTGGAATAAGTATTCAATTTTTTTTTTATTTATATAGATAATGCT
GGTGTTATTGCTAACCCCAAGGGTGAAATGAAGGGTTCCCAAATCACTGGTCCCGTCGCC
AAGGAATGTGCTGACATCTGGCCCAAGGTTGCTTCCAACGCTGGTTCCGTTGTTTGA