Identifiers and Description

Gene Model Identifier

TTHERM_00227270

Standard Name

RPL22 (Ribosomal Protein of the Large subunit #22)

Aliases

PreTt12537 | 19.m00329 | RPL22e

Description

Homolog of Yeast RPL22, Human RPL22

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01776 ) ribosomal L22e protein family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00227270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05502.17.001368147796582e-60ribosomal protein L22 (120 aa)
OxytrichaContig20556.0.g592.0006622580855403e-35Ribosomal L22e protein family
WormBaseWBGene000044342.998577119979921e-31locus:rpl-22 60S ribosomal p
rotein L22 status:Confirmed
UniProt:P52819 protein_id:
CCD63067.1
DictyBaseDDB_G02881017.001594317853847e-31rpl22 on chromosome: 5 positio
n 1106395 to 1107007
Stentor CoeruleusSteCoe_147416.305116760146989e-16
SGDYLR061W0.0000000000005000841553255702RPL22A Protein component of th
e large (60S) ribosomal subuni
t, has similarity to Rpl22Bp a
nd to rat L22 ribosomal protei
n

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00227270(coding)
ATGTCATTCAGAAAGAAAACTAAGTAAGTCAAGAAGGTTAACTTGGGCTTCAAGATCGAC
TGCTCTCAACCCGTTGAAGATAAGGTCATCCTTATCGGTGAATTCGCCGAATTCTTGAAA
TCCAAGATTAAAGTCGGTGGTAAGCTCGGTAACTTGGGTGAAAACATCACCATCAGCAAC
GATGACAAGAAGATTAACGTCTAATCCACCATCCCCTTCTCCAAGAGATACCTTAAGTAC
TTAACCAAGAAGTACCTTAAGAAGTAAGACTTGAGAAACTATCTCTACGTCACCTCTTCT
GACAAGAACTCTTACCAACTTAGATATTTCAACATTCAATAAGACCAAGCTGAGTGA


>TTHERM_00227270(protein)
MSFRKKTKQVKKVNLGFKIDCSQPVEDKVILIGEFAEFLKSKIKVGGKLGNLGENITISN
DDKKINVQSTIPFSKRYLKYLTKKYLKKQDLRNYLYVTSSDKNSYQLRYFNIQQDQAE


>TTHERM_00227270(gene)
ATGTCATTCAGAAAGAAAACTAAGTAAGTCAAGAAGGTTAACTTGGGCTTCAAGATCGAC
TGCTCTCAACCCGTTGAAGATAAGGTCATCCTTATCGGTGAATTCGCCGAATTCTTGAAA
TCCAAGATTAAAGTCGGTGGTAAGCTCGGTAACTTGGGTGAAAACATCACCATCAGCAAC
GATGACAAGAAGATTAACGTCTAATCCACCATCCCCTTCTCCAAGAGATACCTTAAGTAC
TTAACCAAGAAGTACCTTAAGAAGTAAGACTTGAGAAACTATCTCTACGTCACCTCTTCT
GACAAGAACTCTTACCAACTTAGATATTTCAACATTCAATAAGACCAAGCTGAGTGA