Identifiers and Description

Gene Model Identifier

TTHERM_00666540

Standard Name

RPL21 (Ribosomal Protein of the Large subunit #21)

Aliases

PreTt23907 | 99.m00148 | RPL21e

Description

Homolog of Yeast RPL21, Human RPL21; 60S ribosomal protein L21, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01157 ) ribosomal protein L21e

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00666540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16566.12.000383902553626e-9860S ribosomal protein L21 (158
aa)
DictyBaseDDB_G02793879.995739965151785e-43rpl21 on chromosome: 3 positio
n 1751733 to 1752215
OxytrichaContig1175.1.g462.0008536325002377e-42Ribosomal protein L21e
SGDYBR191W5.001052752541194e-37RPL21A Protein component of th
e large (60S) ribosomal subuni
t, nearly identical to Rpl21Bp
and has similarity to rat L21
ribosomal protein
WormBaseWBGene000044339.99723014177113e-33locus:rpl-21 60S ribosomal p
rotein L21 status:Confirmed
UniProt:P34334 protein_id:
CCD64440.1
Stentor CoeruleusSteCoe_100052.3195228302435696e-16

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00666540(coding)
ATGACTCACAGTTACGGTTATAGAAGACAAACTAGAAAGAAATTCGCTAAGGCCTACAAG
ACCAAGGGTCACGTTAGAATTTCCAGATATCTCACTACCTACAAGGTCGGTGAATACGTT
GATATCATGGTTGATGGTTCTCAACACAAGGGTATGCCCTACAAATTATACCACGGAAGA
ACTGGTAAGGTTTTCAACGTTAACCCCAGATCCATCGGTGTTATTGTCCACAGAATCGTC
AATGGTAGATATATTGAAAAGAGACTCCATGTTAAAATTGAACACGTTAGACCTTCCAAC
GTCAAAACCGCTCTCTCCAAGAGATATTAAGCTAACGATTAAGCTAAGGCTGAAGGTAAC
AAGGCTGGTAAGAGAGTCTCCACCAAGAGAAACCCCGGCCAACCTTTGGAAGCTGTCCAA
GTCCAAGGTGCCGTTAACTTCTAACACCCCAAGGTCTTCAGAGAAATTTTCTGA


>TTHERM_00666540(protein)
MTHSYGYRRQTRKKFAKAYKTKGHVRISRYLTTYKVGEYVDIMVDGSQHKGMPYKLYHGR
TGKVFNVNPRSIGVIVHRIVNGRYIEKRLHVKIEHVRPSNVKTALSKRYQANDQAKAEGN
KAGKRVSTKRNPGQPLEAVQVQGAVNFQHPKVFREIF


>TTHERM_00666540(gene)
ATGACTCACAGTTACGGTTATAGAAGACAAACTAGAAAGAAATTCGCTAAGGCCTACAAG
ACCAAGGGTCACGTTAGAATTTCCAGATATCTCACTACCTACAAGGTCGGTGAATACGTT
GATATCATGGTTGATGGTTCTCAACACAAGGGTATGCCCTACAAATTATACCACGGAAGA
ACTGGTAAGGTTTTCAACGTTAACCCCAGATCCATCGGTGTTATTGTCCACAGAATCGTC
AATGGTAGATATATTGAAAAGAGACTCCATGTTAAAATTGAACACGTTAGACCTTCCAAC
GTCAAAACCGCTCTCTCCAAGAGATATTAAGCTAACGATTAAGCTAAGGCTGAAGGTAAC
AAGGCTGGTAAGAGAGTCTCCACCAAGAGAAACCCCGGCCAACCTTTGGAAGCTGTCCAA
GTCCAAGGTGCCGTTAACTTCTAACACCCCAAGGTCTTCAGAGAAATTTTCTGA