Identifiers and Description

Gene Model Identifier

TTHERM_00476670

Standard Name

RPL20 (Ribosomal Protein of the Large subunit #20)

Aliases

PreTt06196 | 58.m00168 | 3719.m00028 | RPL18A

Description

Homolog of Yeast RPL20, Human RPL18A; Ribosomal L18ae protein family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01775 ) ribosomal L18ae protein family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00476670

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14167.19.995516318087232e-125ribosomal L18ae protein family
protein (191 aa)
OxytrichaContig16734.0.g671.0004249259458435e-52Ribosomal L18ae/LX protein dom
ain
WormBaseWBGene000044327.997739975804982e-43locus:rpl-20 60S ribosomal p
rotein L18a status:Confirmed
UniProt:O44480 protein_id
:CCD68709.1
DictyBaseDDB_G02858812.0005131442217614e-40rpl18a on chromosome: 4 positi
on 3775456 to 3776276
SGDYOR312C9.9981864321491e-40RPL20B Protein component of th
e large (60S) ribosomal subuni
t, nearly identical to Rpl20Ap
and has similarity to rat L18
a ribosomal protein
Stentor CoeruleusSteCoe_362501.2995814250075031e-24

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00476670(coding)
ATGGTTAGAAAAGCTGCCCAAGAACCCAAGGATGACACCCTCTAAATGAAGGTCAGACAA
TACGTCGTCTCTGCTGCTAGACTTCCCATCGAATAGGGTACCAAGCCTGAAATTCTCTAA
ATGAGAGTCTTCGCTAGAGATGAAGTCCATGCTAAGACCAAATTCTGGTACAACATGAGA
AAGTTGAACAAGATTAAAAGATCTTAAGGTAGAATCCTCTCCGTTAACGAAATCTACGAA
AAGTCCCTCAACACCGTCAAGACCTACGGTATCGTTCTTAAGTACTAATCTAGAACTGCT
ATCCACAACATGTACAAGGAATACAGAGATGTCTCTTTAAACGGTGCTGTTTCTCAACTT
ATCTAAGATATGGCTGGTAACCACAGAGCTCAACCTGATACCATCCAAATTATCAGAACT
GCCACCCTTGAACCCAAGGACATTAAGAGACCTGCTACCCTCGCCATGAGAAACGCTGCT
CTTAAGTTCCCCATCGTCAAGACCATCCACAGACCCTCCGAAAAGAAATACAGAACTGTT
TACAAGGCCACCAGACCTACCACTTTCTAGTGA


>TTHERM_00476670(protein)
MVRKAAQEPKDDTLQMKVRQYVVSAARLPIEQGTKPEILQMRVFARDEVHAKTKFWYNMR
KLNKIKRSQGRILSVNEIYEKSLNTVKTYGIVLKYQSRTAIHNMYKEYRDVSLNGAVSQL
IQDMAGNHRAQPDTIQIIRTATLEPKDIKRPATLAMRNAALKFPIVKTIHRPSEKKYRTV
YKATRPTTFQ


>TTHERM_00476670(gene)
ATGGTTAGAAAAGCTGCCCAAGAACCCAAGGATGACACCCTCTAAATGAAGGTAGGACCA
GCTTTAAAAATAAAAAAATTTTAATTTCTTCATCAAGTATTTCTTCAGTCTTTGGTAGGA
AGGCATATCATGCTCACCTGACTACCTCATGCTCCTTATTAACTTTAAGAATGCATTTTT
ACACAACATCTCTCTTGGATTTATCAAAAAAAATAATAAGCAAATATTGCTTCAATTAGT
AATTTAACCCTATTAAATATTGCTATCATGTCCAAATCTAGCAACTTTTGAAAAAAATGA
AAAGCAAAGGAGAGGTTTTGCAATATTGGCATTACGCTTCTGATTTCATTCGATCAGAAA
TAACAAAAATAGTGTTCATTATTTGATAGGGAGAGATGGATGGAATTAATTAATAATTAA
TTGCATATTTAGAGAAATACTCAAAATAAAAAGACTGACTTGAATGAAATTAAGTTATCA
TATTTATAATTATTTATTATTAATCAAAAGGTCAGACAATACGTCGTCTCTGCTGCTAGA
CTTCCCATCGAATAGGGTACCAAGCCTGAAATTCTCTAAATGAGAGTCTTCGCTAGAGAT
GAAGTCCATGCTAAGACCAAATTCTGGTAAGATAAATTTAAGATAAATTCAGATTTAGTC
TTCAAAACGAATTAGTCAGAGAGAAAAATATTTTAAACCCATTAACAATCACAATCGTTC
ATTTGCTGTGAGAAAATAAATATACTGGATGGATTAAGCAAAAGGCATTATAGTACAATA
ATTTAAGGTTCTACAATAAAACATATTATCAGTGCAATCTATAAATCAATCAATCAACCA
CTGCATACTAATATATCTTCACTAATACAATATATAAATAAATAAATAAATAAATGAGTG
AGTGAGTGAGTTAGTGAATTAGCTGCATTAATAACAGCAAGCAACAATAAAAAAACAAAT
TCATTCTGTTAAATAAATCTAATAAAAATTTAAAAATTTTAATTAAAAAGTTGAATTAAC
TTAGGCTATAATTCTGCTCTTCTTTAATTAAATGCAAAAATTAGTTTTATGGCTAGGATA
CAAAAAAATTTAATAACCTTAACTTGTTAGAATAAATTTGATTAGATCAACATCATAGTT
TTAGCATTTATTTAAATAAATGAAGGAGCAAACAAACAAGTAAATTAATAAATAAATAAA
TCGATTGTGAAAATGGGAAAGGCTTAAAGTAAAAATAGTTAAAACAATAATATTTAGAAG
GATAGATATATTAATTTATGTAAAAAAAGATCTTAAATCAAAAAAAAATTCAGCGAAATC
AAGCAATATGGGTGAACATATTTAGTTGAAAATATTTATAAAGATAATCCTAAAATTATC
CTGATGAAAAGCAGCAAATATTTCATTTTTAAATATTTCAAAAAAAGCATAGCTTGTAAT
TAAAAAAAAATTATGGAAGCAATCAACAAAATAATTCCACTAATTCGATTTGACTGACAC
TCTTACAAATTCCATTAAATAAATAAATATTAAATATATTTTCTTTTTTAAATAGGTACA
ACATGAGAAAGTTGAACAAGATTAAAAGATCTTAAGGTAGAATCCTCTCCGTTAACGAAA
TCTACGAAAAGTCCCTCAACACCGTCAAGACCTACGGTATCGTTCTTAAGTACTAATCTA
GAACTGCTATCCACAACATGTACAAGGAATACAGAGATGTCTCTTTAAACGGTGCTGTTT
CTCAACTTATCTAAGATATGGCTGGTAACCACAGAGCTCAACCTGATACCATCCAAATTA
TCAGAACTGCCACCCTTGAACCCAAGGACATTAAGAGACCTGCTACCCTCGCCATGAGAG
TAATTTATCAATAATTTATTAAATTAAAAATTCTAATTGAGGACAAACAAAACTTTTCAT
ATTTTATATTTTTAAGAATTCTATTTCCATTTTAAATGAATTATATTGGATCTAATTTAT
TTTTAATGAGATATGTTTGTTTGTCTTTGATTTACTGAAAAAAATATGCTGTTAAAAAAA
ACTATTTATTAAAATTTATCTTCATAAAAATTTAGAACGCTGCTCTTAAGTTCCCCATCG
TCAAGACCATCCACAGACCCTCCGAAAAGAAATACAGAACTGTTTACAAGGCCACCAGAC
CTACCACTTTCTAGTGA