Identifiers and Description

Gene Model Identifier

TTHERM_00716240

Standard Name

RPL2 (Ribosomal Protein of the Large subunit 2)

Aliases

PreTt19096 | 113.m00135 | 3673.m00059 | RPL8

Description

Homolog of yeast RPL2, human RPL2; C-terminal domain containing protein, Named RPL8 in Klinge et al. Science 2011

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR01171 ) ribosomal protein L2
  • ( PF03947 ) Ribosomal Proteins L2, C-terminal domain
  • ( PF00181 ) Ribosomal Proteins L2, RNA binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00716240

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16896.19.997093137033517e-262ribosomal Proteins L2 domain-c
ontaining protein (264 aa)
WormBaseWBGene000044136.998011703086592e-119locus:rpl-2 60S ribosomal pr
otein L8 status:Confirmed
UniProt:Q9XVF7 protein_id:CA
B03792.1
OxytrichaContig22518.0.g918.997487055918214e-111Ribosomal Proteins L2, C-termi
nal domain
SGDYIL018W6.0025840010353464e-108RPL2B Protein component of the
large (60S) ribosomal subunit
, identical to Rpl2Ap and has
similarity to E. coli L2 and r
at L8 ribosomal proteins; expr
ession is upregulated at low t
emperatures
DictyBaseDDB_G02741131.0000198575659891e-106rpl8 on chromosome: 2 position
4593609 to 4595098
Stentor CoeruleusSteCoe_350152.820770088460135e-53

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00716240(coding)
ATGGGTAGAGTTATCAGAGCTCAAAGAAAGGGTCGTGCTAATGGTGTCTACAAATCTCAC
AAGAGTGGTAGAATCGCCCCCGCTCAATACAGAGTTTACGACTTCGCTGAAAGATAAGGT
TACATCAGAGGTTGCATCAGAGACATCGTCCACGAACCTGGTAGAGGTGCTCCCTTAGCT
GAAGTTGCTTTCAGAGATCCCTACAGATACAAGACTAACAAAGAACACTTCATCGCCGCT
GAAGGTTAATATTCCGGTTAATACGTTTACTGCGGTTTGAAGGCTCAAATCGCCGTCGGT
AACGTTCTTCCCATCAACAGAATCCCCGAAGGTACTGTTGTTTGCAACGTCGAAGAAAAG
GTTGGTGACAGAGGTACTTTCTCTAGAGCCTCCGGTTGTTATGCCACCATTATTGGTCAC
TCCGAAGATGGTGACAAGACCAGAATCAGATTACCCTCTGGTGCCAGAAAGACCATTCCT
GGTTCTTGCAGAGCTACTGTTGGTATCGTCGCTGGTGGTGGTAGAACTGATAAGCCCATC
CTCAAGGCCGGTAACCAATTCCACAAATACGCTAGAAAGAGAAAGTCATGGCCCAGAGTT
AGAGGTGTTGCTATGAACCCCGTCGACCATCCTCACGGTGGTGGTAACCATTAACACATC
GGTCACCCCGCTACTGTTTCCAAGTGGGCTTCTGCTGGTCAAAAGGTCGGTCTCAGAGCT
GCCAGAAGAACTGGTCTCGTTAGAGGTGGTCAAAAGGAAAAGATGGCTATGAAGGCTGCT
GCTGCTGGTGTTTGA


>TTHERM_00716240(protein)
MGRVIRAQRKGRANGVYKSHKSGRIAPAQYRVYDFAERQGYIRGCIRDIVHEPGRGAPLA
EVAFRDPYRYKTNKEHFIAAEGQYSGQYVYCGLKAQIAVGNVLPINRIPEGTVVCNVEEK
VGDRGTFSRASGCYATIIGHSEDGDKTRIRLPSGARKTIPGSCRATVGIVAGGGRTDKPI
LKAGNQFHKYARKRKSWPRVRGVAMNPVDHPHGGGNHQHIGHPATVSKWASAGQKVGLRA
ARRTGLVRGGQKEKMAMKAAAAGV


>TTHERM_00716240(gene)
ATGGGTAGAGTTATCAGAGGTACTATAAACTTAAAGACAACGATTGTCAATTTTAATGAG
GGAGCAAGAAGGATAGCAAGCTGAAAGCAAATGACTAATGATTTGGCTAATTCAATTTAA
TTTAATTGGTTTAAATGCAAAAAAATGCCATCCATCAATCACTAAAATCATTAGAAATAA
ATAATACTTTTCTTTTGTTAATTATCAATCAGTCAAACATCTTTCTCTTCAAACTTCTTG
CTCTCTCATTTCTCATATTTATAATCATTCCTATCTAAACAATTCTCTTATTTAAAATAA
TATAGCTCAAAGAAAGGGTCGTGCTAATGGTGTCTACAAATCTCACAAGAGTGGTAGAAT
CGCCCCCGCTCAATACAGAGTTTACGACTTCGCTGAAAGATAAGGGTAATTAACATAACT
TTGATAATGTACAAACAAATAATATATTTTCTCACTCTCATAATACAAACAATCCTTTGT
CAAAAACCTAATCTAACATATTTTCTTCTCAATACTCCCATTCGATTAACAAACAACTGC
AATAGGAATTCTTGCAAGTTTGTCTTCACAAGCAAGGAGTAATAAAAAGGAAATTAGAAA
TGTTTATTAGCAATTCATTAAAAATAGCTAAACTCTCTCTTCTACACAAAGTGAAAGTAG
AAAATAAATCCCACAATAAATCAATCAACAATTAAATTTAGAAAAGATAGCCTTTAAATT
ATTTCTAAACCCCGTTTAAGTAAGATGTAATAAGATAAAAGAGGTTTAAGGTTTCAAAAG
AAAAGTTATAATGCATTTAATGAATGAATAAATGAAGTTAGGTTTTATTTGAAGTCAAAA
TCACAAATATGGTACAAGAATAATTTTATTTAGCTTTTAGGTTCTGTCTGATAAAAAAGG
AAATAAAGAGATAAAACATTTAAATTATTTCGTCATTGTTCATTTAGTGGGATTTGCGTA
CCATAACATATATAAATGTATTGTACAAGTAAATATATGAGCTATTTTCACACTGAAAGA
TATAAAAGCCTTTCGCTAAGAAATCAACTAAGTTAGAAAGAAAGAATGATAGAAAGAGAG
AGAGAGTTAAAGAATTATATTTAGAATTAATCAGTAGAAGAATTTTTTTTTATTAATCAT
CTCAAGAAAAAATTTAGAAAACAACAGAATGAGCAAAAAAAGTATATTTAGCAGCAAAGA
TAAACTAATAAGTCAATAAGGGAATAAGCTCCTCAATTGAACAAACAAACAAATTCATTA
AGCAAATAAGTTTTTATTTAGATAAATATTTTGAGGCTTATTTCTTTCTTACAAGAGATT
ATGAGCAAGCTTAAATTTATTTAGATATAATGAAAAAATGAATTTAAAGTAAAATCAACA
AGTAGAATTTATCAAACAATTATTATGAATAATAAATAATCAATGAAGGTGGTTAAGAGT
GTTTGTATAGAAAATTTTGCAAATAAATAAATAAATAAAGAAATTAATTTTAGAGAGGAA
TGATGAGAAATTTGTTATCTGTTTACATACATACTTTGATATAAAAACTCATTATTTATT
TATTAAATATTTTTAACCTTTTGTTGAATTTATAAAAAATAGTTACATCAGAGGTTGCAT
CAGAGACATCGTCCACGAACCTGGTAGAGGTGCTCCCTTAGCTGAAGTTGCTTTCAGAGA
TCCCTACAGATACAAGACTAACAAAGAACACTTCATCGCCGCTGAAGGTTAATATTCCGG
TTAATACGTTTACTGCGGTTTGAAGGCTCAAATCGCCGTCGGTAACGTTCTTCCCATCAA
CAGAATCCCCGAAGGTACTGTTGTTTGCAACGTCGAAGAAAAGGTTGGTGACAGAGGTAC
TTTCTCTAGAGCCTCCGGTTGTTATGCCACCATTATTGGTCACTCCGAAGATGGTGACAA
GACCAGAATCAGATTACCCTCTGGTGCCAGAAAGACCATTCCTGGTTCTTGCAGAGCTAC
TGTTGGTATCGTCGCTGGTGGTGGTAGAACTGATAAGCCCATCCTCAAGGCCGGTAACCA
ATTCCACAAATACGCTAGAAAGAGAAAGTCATGGCCCAGAGTTAGAGGTGTTGCTATGAA
CCCCGTCGACCATCCTCACGGTGGTGGTAACCATTAACACATCGGTCACCCCGCTACTGT
TTCCAAGTGGGCTTCTGCTGGTCAAAAGGTAATTTGCTTATTCTCTATAATTAATTCAAT
TTTAGTATTTTTTCTAATTAACATTTCCTAATCTTTTTTTAATAATTCAGGTCGGTCTCA
GAGCTGCCAGAAGAACTGGTCTCGTTAGAGGTGGTCAAAAGGAAAAGATGGCTATGAAGG
CTGCTGCTGCTGGTGTTTGA