Identifiers and Description

Gene Model Identifier

TTHERM_00444510

Standard Name

RPL19 (Ribosomal Protein of the Large subunit #19)

Aliases

PreTt03819 | 51.m00185 | 3704.m00040 | RPL19e

Description

Homolog of Yeast RPL19, Human RPL19; Ribosomal protein L19e containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01280 ) ribosomal protein L19e

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00444510

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10906.13.99907102031635e-130ribosomal protein L19e contain
ing protein (186 aa)
OxytrichaContig22564.0.g701.99927841627239e-68Ribosomal protein L19e
WormBaseWBGene000044311.0002012508493003e-67locus:rpl-19 60S ribosomal p
rotein L19 status:Confirmed
UniProt:O02639 protein_id:
CCD63892.1
DictyBaseDDB_G02815653.000235161122315e-61rpl19 on chromosome: 3 positio
n 4825161 to 4825826
SGDYBR084C2.0004062814618821e-57-A RPL19A Protein component of
the large (60S) ribosomal sub
unit, nearly identical to Rpl1
9Bp and has similarity to rat
L19 ribosomal protein; rpl19a
and rpl19b single null mutatio
ns result in slow growth, whil
e the double null mutation is
lethal
Stentor CoeruleusSteCoe_393473.975449735908647e-31

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00444510(coding)
ATGGTATCCTTAAGACTTTAAAAGAGATTAGCCGCTTCCGTTTTGAAGTGCGGTCAAAAG
AGATTATGGTTAGATCCCAATGAATCCTCCGAAATTTCTATGGCTAACTCCAGAGCTTCC
ATCAGAAAGCTCATCAAGGACGGTTTGGTCATGAAGAGATCTACTGTCATTCACTCTAGA
TCTAGAGCTAGAGCTTTCCTTGAAGCCAAGAGAAAGGGTAGACACACTGGTTCCGGTAAG
AGAAAAGGTACCAGAAACGCTAGAATGCCCACCAAGGTTCTATGGATGAGAAGACAAAGA
GTTCTCAGAAGACTCCTCAGAAAGTACAGAGCTGCCAAGAAGATCGATAAGCACTAATAT
CACGAATTCTACTTGGGTTCTAAGGGTAACTTGTACAAGAACAAGACTGTCTTGATCGAA
GCTATCCACGTCTCCAAGGCTGACAAGATCAAGTCCGATAAGTTAACTTCCCAACAAGAA
GCCAGAAGAGCTAAGAACACCGCTTCTAGAGCTAAGAGAAACGAAAAGGCCTAAATCGTT
GCTAAGGTCGATGTTTGA


>TTHERM_00444510(protein)
MVSLRLQKRLAASVLKCGQKRLWLDPNESSEISMANSRASIRKLIKDGLVMKRSTVIHSR
SRARAFLEAKRKGRHTGSGKRKGTRNARMPTKVLWMRRQRVLRRLLRKYRAAKKIDKHQY
HEFYLGSKGNLYKNKTVLIEAIHVSKADKIKSDKLTSQQEARRAKNTASRAKRNEKAQIV
AKVDV


>TTHERM_00444510(gene)
ATGGTATCCTTAAGACTTTAAAAGAGATTAGCCGCTTCCGTTTTGAAGTGCGGTCAAAAG
AGATTATGGTTAGATCCCAATGAATCCTCCGAAATTTCTATGGCTAACTCCAGTAAAATT
TCTATTAAATGCTCTCCCATTTTATGCAAAAAGTTATAGCTGATCATACATTAATTCAAT
AATATTTTTCTTCAACTATTGCCATAAGGTGTATGAAAAACATATTGTAACTTTAGCATA
TATAAAAGAAATTTTCTTGAGCAAATCTCAATATGAAGTATGCATGCCATATTTAATATA
TTATTTATTTAATTATAACAGGAGCTTCCATCAGAAAGCTCATCAAGGACGGTTTGGTCA
TGAAGAGATCTACTGTCATTCACTCTAGATCTAGAGCTAGAGCTTTCCTTGAAGCCAAGA
GAAAGGGTACTTTTACATTATTCACAAGCCTAATATTATATTTATTTTCCTAATCTTTTA
ATGGTTGGGAAAACTGACTTTTACCACAGCAGAAGTGAGATGATTTAGTAGTAAGTAGCT
CTCTTCAAAATGAATAATGTTTGTATATAATTAAAATGAATTAAGAGTAAATTAATAGTT
TAAAATTATTGCTGAGATCGAAATATAAAAAATCTAGCATTACAATTCGATTATGAAAAA
ACCAAATACGCTTTTAAAAATCTTACTAATTGCATAAGTAACATGAAAAGAGTTCTTAAG
ATACAATAAAATGTAAATAGAATAAAGTATTTTTATATAAAAGAAGAAAACAATAAATAG
ATGCATTTAAAAGTGTTAGTTAGCAAAGTGGATTTTATTTAATAAATTAATTTCAAACAG
AAAACATAATACATAATACATAACATACTTTTAAAGAGACCAAATCTATAATATAATATT
ATTTAAAGCAGATTTCATAGTAACCAAATCAAATTAAATCAAAGAAAGCAGATCAATCAA
AGCTAAATTTTGCTAAAACTGAAGTTTATTGTGAGCTAAAAATTTTATAAGCATATACAA
ATATTTTTAGCTTATGATTAGTGTAATAGTGGCAATTTTGAATCTTATAAATTGGATGCT
TTACTTATGAGAATAATAACAACAACAAAAACAACTGAAATCTACTTTAAATGAAGTTAG
ATCATTGGGAATTTTTATGCTCGCGGATTTAATAAGAAGTGAATAAAAATGTATTCCCAT
TATATTGTATTTTAGCTAAATTGGATTGTTAATGTAATAGATGAATACTCTTGATATTAG
CTTTTCAATGAATGAAATAAATATTATGATTCATAAAAAGAGGCAACAAACTACTAAATC
AATCAAAATTATCTGCAGAGAAAATAAAAATATGATTATTATTAATTAACTAATCAATTT
ATCTTGCAGTTTTATATCGAAAATCTAATCATTTATCTTATCAAAATTATAGGTAGACAC
ACTGGTTCCGGTAAGAGAAAAGGTACCAGAAACGCTAGAATGCCCACCAAGGTTCTATGG
ATGAGAAGACAAAGAGTTCTCAGAAGACTCCTCAGAAAGTACAGAGCTGCCAAGAAGATC
GATAAGCACTAGTAATTTTTAAAATATATTTGATTATATTTTTAACTAAATAAATAAATA
AATATGGCTGTTCGATTATGCTAACTATTATTTATAATAAATAGATATCACGAATTCTAC
TTGGGTTCTAAGGGTAACTTGTACAAGAACAAGACTGTCTTGATCGAAGCTATCCACGTC
TCCAAGGCTGACAAGATCAAGTCCGATAAGTTAACTTCCCAACAAGAAGCCAGAAGAGCT
AAGAACACCGCTTCTAGAGCTAAGAGAAACGAAAAGGCCTAAATCGTTGCTAAGGTCGAT
GTTTGA