Identifiers and Description

Gene Model Identifier

TTHERM_00338210

Standard Name

RPL18 (Ribosomal Protein of the Large subunit #18)

Aliases

PreTt06062 | 34.m00299 | 3689.m00095 | RPL18e

Description

Homolog of Yeast RPL18, Human RPL18

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00256 ) ribosomal protein L15
  • ( PF00828 ) eukaryotic ribosomal protein L18

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00338210

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15128.19.997093137033517e-262hypothetical protein (708 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00338210(coding)
ATGGACACAAATAGTTAGGGATTCAAATTTAACACTATGAACAGCAGCTAAGGCAACCAA
TAAAACAATGATTATGATGAAGATATTATTGTGGAAGAAGATACAAAACATTAGTTGTAC
TAATTTCGTGAAGAGCATAGTGTAGAAATCCGTCAAAGCAAACGTAAGCAAATATTGAAA
AAAAATCGTGTACTACCTGTAGAGCATTAGCACAGTTTTAATAATCAAACTTTAGGAGAT
TTCCCTGATATTAATGCTATTCAGGGATAAACAATTGAAGAATTTTAAGCTTTTGTTAAA
TAATACTTACCTGTTAGCTTAGAGGCTGCTTCAGAATCATAGAGATGCGATAATGTTAAA
GTTTTAGTTTCTGCAATAACAAGCAATTGTTCTCCACAGTTCTTTATATTTGCAACAAGC
GAGCTTTACAACTACTTTTAGGATGAAATTCCAATTTTCAATATATTTATTGCTGATATT
TATCGCTTTATCGATATAATCATTGCATCTGATTTTACTAAGAAGGCTAAGATTATCTTG
AATGATTGGAGAACTGCTTTAGGTTTAGTTCCTGTATAGAATAATTCTTATTTTGTTCCT
ATTTTAAGGATAGACTAAAATCTCGCTAGAAGATATTTAATTGGTTGTTTAAATATTCTT
TGTGGTATTTCAAGAGGTGGTGACAATCACTGCTCTATATTTGAAACTAATGACCTTTTA
CAAACACTTTTTGATATATTTGATGCCACAAAAACAGAAAGAGACATTACTGAAATTATG
TTGTATACAATTGGTAACATTGCAGCAACTAGAAATTAATGGCGTATTTTTTTTATGCAG
CGCGACTTTCACAATACTATACTTAATTATTTGAAGTATGCCCCTAAAAATCAAGAAAAT
ATCCTTTTACACCGTCGTATTTGCTGGTGCCTGAGTAACTTTACTCGTGATTATGTTTCA
GTACAGTAAAATAATGGGCAATCTTAAATTTTAGCTAACGGTTAAGTTGTTACAGAAATA
GTTGACAATTCTTAATTCGATTTTTCACATATTAAGAATTTGACTGACACATTTATTGAA
TATTAAGATCCAGAAATCAGGACAGACATCTCTTGGACTTTTTAGCAGCTAGTGATTATT
TTCTTCCCTAAGTTAAATGGTAACATAATCATGCCAGGAACTGCTGATGACTATAAAGCA
AATAACAATATTAGCCAGTAGCAAAAACAGTATTACAAATCATAAGTAACAGAAAAAATT
GGATTTTTAATCTAGAATGGAATTTGCGAATTTATTAATGAAGCCTTTAAATCTTCTGAT
ATGACGATATTAGTACCTATACTAAGAATTATTAACAGAATCATGGCAGGATCTGCTCCA
GTCTTAGAACTTTTCTTTAATAAATGTAATGACACTATAGTTCAGTGTACTACTAAGCAT
CTTTAAAATTAGGTCTAACTAATTAGGAAAGAAGTAGTTAAAACATTGCATTATATGTTT
GCATGTGAATATGATGGTCATAAGGAGATATGGTTTAACAGATTTATGCAAATAGTTATG
GTCAGATTCAACACAGAAGTGCTAAGCGTCAAAGAGGAGGTATATAAGTTGCTAAATACC
ATTATTGATAAAGTTAACCCAAACCACTTCGAATTTTTAACTTTGAATGGAGCAAACAGG
TTCTGCATTTTCAGAGTAATGAGAAATTCTTTGAGTTCATATGAAACAAAACCTGAAGTT
GTCATAACTATTTTAAGCATTTTGCTTAAAGTGTTAAGCTATTATAAGCTAGGAAACTCA
AATTTAGAAAATCAAAAAATAAAAAGAATAATATAAATTATAGATTAAAACAATCTTCCT
CAATTTGTTGAATAACTATAGGAGCATCAACAAAAAGGAATCTATGATTTTGCAATATAA
TTTATAGAATTATATAACAAGATTTAAGAAAACATTATTGACGAAGAACATAAAGAAATC
AGCTCATAGCCCATAAGGCAAGATTATATTAGACAAAATAAATTTGATAATTAAAATTTT
GAGAAATTACATGAAGAATAAAAGATTTGA


>TTHERM_00338210(protein)
MDTNSQGFKFNTMNSSQGNQQNNDYDEDIIVEEDTKHQLYQFREEHSVEIRQSKRKQILK
KNRVLPVEHQHSFNNQTLGDFPDINAIQGQTIEEFQAFVKQYLPVSLEAASESQRCDNVK
VLVSAITSNCSPQFFIFATSELYNYFQDEIPIFNIFIADIYRFIDIIIASDFTKKAKIIL
NDWRTALGLVPVQNNSYFVPILRIDQNLARRYLIGCLNILCGISRGGDNHCSIFETNDLL
QTLFDIFDATKTERDITEIMLYTIGNIAATRNQWRIFFMQRDFHNTILNYLKYAPKNQEN
ILLHRRICWCLSNFTRDYVSVQQNNGQSQILANGQVVTEIVDNSQFDFSHIKNLTDTFIE
YQDPEIRTDISWTFQQLVIIFFPKLNGNIIMPGTADDYKANNNISQQQKQYYKSQVTEKI
GFLIQNGICEFINEAFKSSDMTILVPILRIINRIMAGSAPVLELFFNKCNDTIVQCTTKH
LQNQVQLIRKEVVKTLHYMFACEYDGHKEIWFNRFMQIVMVRFNTEVLSVKEEVYKLLNT
IIDKVNPNHFEFLTLNGANRFCIFRVMRNSLSSYETKPEVVITILSILLKVLSYYKLGNS
NLENQKIKRIIQIIDQNNLPQFVEQLQEHQQKGIYDFAIQFIELYNKIQENIIDEEHKEI
SSQPIRQDYIRQNKFDNQNFEKLHEEQKI


>TTHERM_00338210(gene)
ATGGACACAAATAGTTAGGGATTCAAATTTAACACTATGAACAGCAGCTAAGGCAACCAA
TAAAACAATGATTATGATGAAGATATTATTGTGGAAGAAGATACAAAACATTAGTTGTAC
TAATTTCGTGAAGAGCATAGTGTAGAAATCCGTCAAAGCAAACGTAAGCAAATATTGAAA
AAAAATCGTGTACTACCTGTAGAGCATTAGCACAGTTTTAATAATCAAACTTTAGGAGAT
TTCCCTGATATTAATGCTATTCAGGGATAAACAATTGAAGAATTTTAAGCTTTTGTTAAA
TAATACTTACCTGTTAGCTTAGAGGCTGCTTCAGAATCATAGAGATGCGATAATGTTAAA
GTTTTAGTTTCTGCAATAACAAGCAATTGTTCTCCACAGTTCTTTATATTTGCAACAAGC
GAGCTTTACAACTACTTTTAGGATGAAATTCCAATTTTCAATATATTTATTGCTGATATT
TATCGCTTTATCGATATAATCATTGCATCTGATTTTACTAAGAAGGCTAAGATTATCTTG
AATGATTGGAGAACTGCTTTAGGTTTAGTTCCTGTATAGAATAATTCTTATTTTGTTCCT
ATTTTAAGGATAGACTAAAATCTCGCTAGAAGATATTTAATTGGTTGTTTAAATATTCTT
TGTGGTATTTCAAGAGGTGGTGACAATCACTGCTCTATATTTGAAACTAATGACCTTTTA
CAAACACTTTTTGATATATTTGATGCCACAAAAACAGAAAGAGACATTACTGAAATTATG
TTGTATACAATTGGTAACATTGCAGCAACTAGAAATTAATGGCGTATTTTTTTTATGCAG
CGCGACTTTCACAATACTATACTTAATTATTTGAAGTATGCCCCTAAAAATCAAGAAAAT
ATCCTTTTACACCGTCGTATTTGCTGGTGCCTGAGTAACTTTACTCGTGATTATGTTTCA
GTACAGTAAAATAATGGGCAATCTTAAATTTTAGCTAACGGTTAAGTTGTTACAGAAATA
GTTGACAATTCTTAATTCGATTTTTCACATATTAAGAATTTGACTGACACATTTATTGAA
TATTAAGATCCAGAAATCAGGACAGACATCTCTTGGACTTTTTAGCAGCTAGTGATTATT
TTCTTCCCTAAGTTAAATGGTAACATAATCATGCCAGGAACTGCTGATGACTATAAAGCA
AATAACAATATTAGCCAGTAGCAAAAACAGTATTACAAATCATAAGTAACAGAAAAAATT
GGATTTTTAATCTAGAATGGAATTTGCGAATTTATTAATGAAGCCTTTAAATCTTCTGAT
ATGACGATATTAGTACCTATACTAAGAATTATTAACAGAATCATGGCAGGATCTGCTCCA
GTCTTAGAACTTTTCTTTAATAAATGTAATGACACTATAGTTCAGTGTACTACTAAGCAT
CTTTAAAATTAGGTCTAACTAATTAGGAAAGAAGTAGTTAAAACATTGCATTATATGTTT
GCATGTGAATATGATGGTCATAAGGAGATATGGTTTAACAGATTTATGCAAATAGTTATG
GTCAGATTCAACACAGAAGTGCTAAGCGTCAAAGAGGAGGTATATAAGTTGCTAAATACC
ATTATTGATAAAGTTAACCCAAACCACTTCGAATTTTTAACTTTGAATGGAGCAAACAGG
TTCTGCATTTTCAGAGTAATGAGAAATTCTTTGAGTTCATATGAAACAAAACCTGAAGTT
GTCATAACTATTTTAAGCATTTTGCTTAAAGTGTTAAGCTATTATAAGCTAGGAAACTCA
AATTTAGAAAATCAAAAAATAAAAAGAATAATATAAATTATAGATTAAAACAATCTTCCT
CAATTTGTTGAATAACTATAGGAGCATCAACAAAAAGGAATCTATGATTTTGCAATATAA
TTTATAGAATTATATAACAAGATTTAAGAAAACATTATTGACGAAGAACATAAAGAAATC
AGCTCATAGCCCATAAGGCAAGATTATATTAGACAAAATAAATTTGATAATTAAAATTTT
GAGAAATTACATGAAGAATAAAAGATTTGA