Identifiers and Description

Gene Model Identifier

TTHERM_00339810

Standard Name

RPL17 (Ribosomal Protein of the Large subunit #17)

Aliases

PreTt06122 | 34.m00359 | 3689.m00153

Description

Homolog of yeast RPL17, Human RPL17, Bacteria L22;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00339810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_235170
Tetrahymena borealisEI9_15080.12.000234809436283e-103hypothetical protein (184 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00339810(coding)
ATGAACTAAAACTATCTTTATCTTCCTTCTGACAAAATAGATTAATATTTGTCAAACATG
GAAAAAGAATTCATAAAAAGTGAAGAGGAATGCAAATTTTAAAATGAGATGTATACCATG
AAAAAAATAGATAACATTGACTCTTTATTTGAACTTTATCACAAACTCATAAGATTTGAC
TTGTTTTTTTAGAATTAATTCAGCCAAAAGGCTTCAACTATTATTTCAGATAAAAAGCTG
AGATCAACAAACATTCAACAGTTCAAAGAGATGTTTCTTAAAAGAATGAAAGATGAAATC
AGAAATCCCGAATATAAAAATGAAGAATCAATATTTTAATTTTTGGTTTAAAGATCTTCC
GATAATGAAATAATTTAAAAAATAGGCATGTCAATTTTCAAAGAAGTTTTGAGCAACAAC
CCAGATATGCTTCTTATCTTTAAAGATATTTTTGGATATAAACCTTGCACAGACTATGAG
ATCTATAGTTATTTAGACTGCTAGCTTGCTGGATCTATAACTATTTAAGAAAATAGCGAT
AAAAAGCTTGTATTTAAAGCTGATTTAACTCATTTCCGAGATAAGCTTTATATTAAAGAC
TGTATGTAGCTTGTTAAAAGCGTGCTAGTTTTCTCTTTTATATTTGATATGATAATGCAT
GTTCTATTCACTCTATCTGGTAAAGTATTTGAGTACAATTATAACTTAAGCCTGCTTTGT
CGCGAGAATTGTTCTGGGATAACACACTTGAAGGGAATATTAAATTAAGCTTAAAAGTGT
TATTATACTATCAAATTAATAGAATAATAAGCTGAATATGACGAACAAGATATAAAGCTT
TGA


>TTHERM_00339810(protein)
MNQNYLYLPSDKIDQYLSNMEKEFIKSEEECKFQNEMYTMKKIDNIDSLFELYHKLIRFD
LFFQNQFSQKASTIISDKKLRSTNIQQFKEMFLKRMKDEIRNPEYKNEESIFQFLVQRSS
DNEIIQKIGMSIFKEVLSNNPDMLLIFKDIFGYKPCTDYEIYSYLDCQLAGSITIQENSD
KKLVFKADLTHFRDKLYIKDCMQLVKSVLVFSFIFDMIMHVLFTLSGKVFEYNYNLSLLC
RENCSGITHLKGILNQAQKCYYTIKLIEQQAEYDEQDIKL


>TTHERM_00339810(gene)
ATGAACTAAAACTATCTTTATCTTCCTTCTGACAAAATAGATTAATATTTGTCAAACATG
GAAAAAGAATTCATAAAAAGTGAAGAGGAATGCAAATTTTAAAATGAGATGTATACCATG
AAAAAAATAGATAACATTGACTCTTTATTTGAACTTTATCACAAACTCATAAGATTTGAC
TTGTTTTTTTAGAATTAATTCAGCCAAAAGGCTTCAACTATTATTTCAGATAAAAAGCTG
AGATCAACAAACATTCAACAGTTCAAAGAGATGTTTCTTAAAAGAATGAAAGATGAAATC
AGAAATCCCGAATATAAAAATGAAGAATCAATATTTTAATTTTTGGTTTAAAGATCTTCC
GATAATGAAATAATTTAAAAAATAGGCATGTCAATTTTCAAAGAAGTAAATTTTTAATTT
TATTTAAAAAATGAGTATTTAATTAATATTTTTAATAAAAGGTTTTGAGCAACAACCCAG
ATATGCTTCTTATCTTTAAAGATATTTTTGGATATAAACCTTGCACAGACTATGAGATCT
ATAGTTATTTAGACTGCTAGCTTGCTGGATCTATAACTATTTAAGAAAATAGCGATAAAA
AGCTTGTATTTAAAGCTGATTTAACTCATTTCCGAGATAAGCTTTATATTAAAGACTGTA
TGTAGCTTGTTAAAAGCGTGCTAGTTTTCTCTTTTATATTTGATATGATAATGCATGTTC
TATTCACTCTATCTGGTAAAGTATTTGAGTACAATTATAACTTAAGCCTGCTTTGTCGCG
AGAATTGTTCTGGGATAACACACTTGAAGGGAATATTAAATTAAGCTTAAAAGTGTTATT
ATACTATCAAATTAATAGAATAATAAGCTGAATATGACGAACAAGATATAAAGCTTTGA