Identifiers and Description

Gene Model Identifier

TTHERM_00732640

Standard Name

RPL16 (Ribosomal Protein of the Large subunit #16)

Aliases

PreTt02785 | 119.m00110 | RPL13-E.coli | RPL13A

Description

Homolog of yeast RPL16, Human RPL13A, Bacteria RPL13; Ribosomal protein L13 containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00732640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18473.12.000147820282363e-173ribosomal protein L13 containi
ng protein (271 aa)
OxytrichaContig20852.0.g286.998089991989877e-78Ribosomal protein L13
DictyBaseDDB_G02758816.001629673589058e-65rpl13a on chromosome: 2 positi
on 5876511 to 5877654
SGDYNL069C1.0004460510701209e-64RPL16B N-terminally acetylated
protein component of the larg
e (60S) ribosomal subunit, bin
ds to 5.8 S rRNA; has similari
ty to Rpl16Ap, E. coli L13 and
rat L13a ribosomal proteins;
transcriptionally regulated by
Rap1p
WormBaseWBGene000044283.9998411574835458e-50locus:rpl-16 60S ribosomal p
rotein L13a status:Confirmed
UniProt:Q27389 protein_id
:CAA86515.1
Stentor CoeruleusSteCoe_339291.0806392777072785e-30

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00732640(coding)
ATGATAAAAGGGCAAATTAAGAGGGAGGTTAAAAAGATTAATTAATAGTTAATGTGGGGA
AAGTAAAGGGACTCTTTTAATTAAGAAAATAATAAACCTAAGGACACATTCATTTAAGAT
TAGCAATTGATAAAGGAAATTAATAAAGTAAAAAAAATAAAATTAAGAGAAGGATAAAAA
ATAAATTAAATAAATAAATAGAAATAATAAAGGAAAATGTTCGACAAGCTTGTAGTTATT
GATGCTAAGGGTCACTTATTGGGTAGACTCGCTTCTTACGTTGCCAAGGAACTTTTGAGT
GGTCAAAGAATTGTTGTTGTTAGAACTGAAGCTATTAACATCTCTGGCTCTCTCTTCAGA
AACAGAGTTAAATTCTCCGAATTCCTTAACAAATGGATGAACCACAACCCCAGAAGAGGT
GTTCAACATTTCAGAGCTCCCTCTAGAATTTTCTGGAGAGCCGTCAGAGGTATGCTCCCT
CATAAGACCCCCAAGGGTGCTGCTGCCTTAGAAAGACTAAAAATTTTCGAAGGTATCCCC
ACCCCCTACGACAGAGTTAAGAAGTAAGTCGTTGTCGATGCCTTGAAGGTCTAAAGATTA
AGAAACTCTAGACCCGTCTGCAAGTTGGGTGACTTGAGTGCTTCCGTTGGTTGGGGCAAA
CAAACCCTCATCGAAAAGCTCGAAGAAAAGAGAAGAGCTAGAGCTAAAACCTACCACGAT
AAGAAGGTTAAGTAAGCTGATGCCAGAAAGAAGGAACTCGCTGCTCCTGCTCTTAAGGCT
ATCAAGGATAAACTCGCCTAATTCGGTTACTGA


>TTHERM_00732640(protein)
MIKGQIKREVKKINQQLMWGKQRDSFNQENNKPKDTFIQDQQLIKEINKVKKIKLREGQK
INQINKQKQQRKMFDKLVVIDAKGHLLGRLASYVAKELLSGQRIVVVRTEAINISGSLFR
NRVKFSEFLNKWMNHNPRRGVQHFRAPSRIFWRAVRGMLPHKTPKGAAALERLKIFEGIP
TPYDRVKKQVVVDALKVQRLRNSRPVCKLGDLSASVGWGKQTLIEKLEEKRRARAKTYHD
KKVKQADARKKELAAPALKAIKDKLAQFGY


>TTHERM_00732640(gene)
ATGATAAAAGGGCAAATTAAGAGGGAGGTTAAAAAGATTAATTAATAGTTAATGTGGGGA
AAGTAAAGGGACTCTTTTAATTAAGAAAATAATAAACCTAAGGACACATTCATTTAAGAT
TAGCAATTGATAAAGGAAATTAATAAAGTAAAAAAAATAAAATTAAGAGAAGGATAAAAA
ATAAATTAAATAAATAAATAGAAATAATAAAGGAAAATGTTCGACAAGCTTGTAGTTATT
GATGCTAAGGGTCACTTATTGGGTAGACTCGCTTCTTACGTTGCCAAGGAACTTTTGAGT
GGTCAAAGAATTGTTGTTGTTAGAACTGAAGCTATTAACATCTCTGGCTCTCTCTTCAGA
AACAGAGTTAAATTCTCCGAATTCCTTAACAAATGGATGAACCACAACCCCAGAAGAGGT
GTTCAACATTTCAGAGCTCCCTCTAGAATTTTCTGGAGAGCCGTCAGAGGTATGCTCCCT
CATAAGACCCCCAAGGGTGCTGCTGCCTTAGGTAATAAAATTTTCTAAAATGATTGTTTG
TTTATAAATTGCCAAGCTGACTGACTGATTAAGTAAAGAACGAAATTAACAATATATTGT
CTAACTTATTAAAAAAATGTATAAAAACGCAATATGATTTATCATAATATTAAAATGTTT
TGTTTTTAATTCCCCTTATTTAATCGCTTTTCACTAGTTTTTAAAGTTTTTCTTGACTAG
TATGGATTAGTGAATAATGAGTAGGTCTTTCAAATCAAGCTTTTGAGATATTTTGTTCAT
TTTATAAGGTGATTTCTTATAAACTAGTAGTTTATACAATTAAAAAACCTTAGCTTCTTT
GCCGAAATATCAAACTAGCAAATCATTTTAAAGGGTTATTATAGCTTTCAAATGTTTAAT
TGAATTTTCATCAAAACAAAAATTGCAAAAACATTAAGATTACTAGGTAGAATAAATGCA
AAAATAAATATGACTACTAACTATACAATTTCAAATTAACAACTATTTTCAAGAGTATTA
AAGGAAATTGAGAGTGTTATGCAAAACACTTGTATCTATTTATCTCCTTCTCATAATATC
AAAAAACAGTTACTATCTATCTATATATCTTCAAAGGAGTATTAAAGTATGAAATTAGTA
GAATTCGAAGCTGAAACAAAATTAATTAAGTTTTATATAGCATTTAAATATCCATAGAGC
AATTTATCACACAGCATATTAAAAAAGCATAGGTTATTTATTATATCTTATTCTAATCTT
AGCAGACTTGCAAAATTATTTTTAGAATATTGATGTAGGATTTTTGATGCTTTGAACAAT
ATAATAAGGTAGAATCAATATTAAATTTGATTGCTAAATCTACTTTGCTACATAAGCAAA
AAAAGAATATGCATTTGAATACTTTTTGAAAACTTTCACTATAAACCGATTGTTTGAATG
AATTAATAAATAAATGAGTGCATTTATGAATGAATGATTTGAAAATATTTGTTATAAAAA
AGTATTTCTGACCTAATTTAGATAAAAATAAATACCCTTTAGGTTGAATTATACATAAAC
AATCTTAATAAACTAAACAAAACAAAACACATTAAACAAGACAATAATATTTTTAATTAG
ATTCTTAAAGTTTTAATTAGTTTGGCTATTTATAAAATGAAAAAATTTATTTTAACCATC
AACTCATCAATCTTATTTTATAATAAACAGAAAGACTAAAAATTTTCGAAGGTATCCCCA
CCCCCTACGACAGAGTTAAGAAGTAAGTCGTTGTCGATGCCTTGAAGGTCTAAAGATTAA
GAAACTCTAGACCCGTCTGCAAGTTGGGTGACTTGAGTGCTTCCGTTGGTTGGGGCAAAC
AAACCCTCATCGAAAAGCTCGAAGAAAAGAGAAGAGCTAGAGCTAAAACCTACCACGATA
AGAAGGTTAAGTAAGCTGATGCCAGAAAGAAGGAACTCGCTGCTCCTGCTCTTAAGGCTA
TCAAGGATAAACTCGCCTAATTCGGTTACTGA