Identifiers and Description

Gene Model Identifier

TTHERM_00697490

Standard Name

RPL14 (Ribosomal protein of the large subunit)

Aliases

PreTt17541 | 108.m00193 | 3818.m00726 | RPL14e

Description

Homolog of yeast RPL14/(RPL14e)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00697490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18115.11.0002335610448659e-38hypothetical protein (88 aa)
OxytrichaContig22158.0.g46.999211576891585e-27Ribosomal protein L14
SGDYHL001W2.000620012690291e-23RPL14B Protein component of th
e large (60S) ribosomal subuni
t, nearly identical to Rpl14Ap
and has similarity to rat L14
ribosomal protein
WormBaseWBGene000044262.9990241513684e-21locus:rpl-14 status:Confirme
d UniProt:Q9XVE9 protein_i
d:CAB03835.1
DictyBaseDDB_G02779753.998609120989657e-17rpl14 on chromosome: 3 positio
n 87206 to 87758

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00697490(coding)
ATGTCCCATTATTTTGTTCCTATGTTAATGAGTTATTTTGTTAAAATTAAAAAGGTTTTC
AACAAATTCGTTCAAGTCGGTAGAGTCGTTTACATCAACTACGGTGCTGATAAGGGTAAA
CTCGCTGTTATCGTTAACATCATCAACTAAAACAGAATCCTTATTGATGGTGAACACATT
GTTAGACAAGTTATTCCCATCAGAAGAGTCCACCTTACCAAGTTCTAAATTGATAATGTT
GAACTCAACCAAAGAACCGTCTTATTGAAGAAGAAGATCGCTAAGTTCGACTTAACCAAG
AAGTACGCTGAAACCTCCTTCGCTAAGAAGTAAGCTATCAAGACCAAGAGAGCTAACCTC
GGTGATTTCGATAGATTCAGAGTTATGGTTCTTAAGAAGAAGCTCGCTAGAACCAGCGCT
AAGTCTAAGTGA


>TTHERM_00697490(protein)
MSHYFVPMLMSYFVKIKKVFNKFVQVGRVVYINYGADKGKLAVIVNIINQNRILIDGEHI
VRQVIPIRRVHLTKFQIDNVELNQRTVLLKKKIAKFDLTKKYAETSFAKKQAIKTKRANL
GDFDRFRVMVLKKKLARTSAKSK


>TTHERM_00697490(gene)
ATGTCCCATTATTTTGTTCCTATGTTAATGAGTTATTTTGTTAAAATTAAAAAGGTTTTC
AACAAATTCGTTCAAGTCGGTAGAGTCGTTTACATCAACTACGGTGCTGATAAGGGTAAA
CTCGCTGTTATCGTTAACATCATCAACTAAAACAGAATCCTTATTGATGGTGAACACATT
GTTAGACAAGTTATTCCCATCAGAAGAGTCCACCTTACCAAGTTCTAAATTGATAATGTT
GAACTCAACCAAAGAACCGTCTTATTGAAGTAGAGATATTCTTATATTTTTTACTATATT
TTTAAAAAGCTCAAAATTCTCTAAATCATCATCTCACACATTAAATGGATTATTTTACAA
ATGCACTCAGAAAATTTGAATTTGGTATTATCAAGCTAATTTTTAATCTACAATTAGCAA
ATCTAAGTAGAAATCTATTTAATTGCTTGAAGCATGAGTGAATTGTTTTGCAAAGGAAAA
ATTGCTGTAAATAGATTCAAAATAGTAATAAAAAGGGAATTTAACAAATAAGTTGGAGTA
ATTTAAAAAAACTCTTAAGCAAGAAACGGATTTGAAATTAGAATTTCATAAAAGTCTAAC
AATAGGCATACTTAGCTTTGAAAAGTATAAATAATAATCAAATGAGACGCAATACTGAAT
AGTGATCTATGTTTTAGTTTAATTCAAGCAAAGTATAGGAAAAGAATAAAAAGCATTTTC
GTAACAATAAGTTTATTTTGAAATATGAACTAGTCTTGAATTTTGTTTTCAAATTTAAAA
CCTTTTACTTTCTTAGTAAGTAATATTTAGCAACAAATATCTTCAAATTAATTTATTATT
AGTTAGAAGGAAATAAATAATTCAAGCTAAGTATTAAAGTAAGTAGAGAGAATGAGGATA
ACATTTATGATAAATGCGTTTTTTCCAGATCTTAAATAAATGATACCGTTTATTGTTTGA
ATTAAGCAATTTGTTAAATTCTAGCTAAAAAATTTAGTTTTTGAATGAAAAAATAAAGAA
AAATACAAAATGAATCTATCTATTAATTAACCAATCTATCTATTAATAAATCAATCTACT
TTCTAAAATATCAATTAATGTGTTGAAGATGAGTGATAAAAGAATTCAAAAAATATAAAT
ACATACTTACTTAACAATTTCTAAACATTACTAATATTTTTAAATAGGAAGAAGATCGCT
AAGTTCGACTTAACCAAGAAGTACGCTGAAACCTCCTTCGCTAAGAAGTAAGCTATCAAG
ACCAAGAGAGCTAACCTCGGTGATTTCGATAGATTCAGAGTTATGGTTCTTAAGAAGAAG
GTAAATAATTAATTATGAAATAAATCTGAAACAAATAAAAATATTTTCTTATTTTAAATA
AAGCTCGCTAGAACCAGCGCTAAGTCTAAGTGA