Identifiers and Description

Gene Model Identifier

TTHERM_00578640

Standard Name

RPL13 (Ribosomal protein of the large subunit)

Aliases

78.m00129 | PreTt05757 | 3733.m00024

Description

Homolog of yeast RPL13/(RPL13e)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01294 ) ribosomal protein L13e

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00578640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16289.11.9990002532767049e-131ribosomal protein L13e contain
ing protein (205 aa)
OxytrichaContig4065.0.1.g963.000458792073453e-56Ribosomal protein L13e
DictyBaseDDB_G02918702.9993743585281133e-40rpl13 on chromosome: 6 positio
n 852689 to 853474
WormBaseWBGene000044257.003455847728069e-40locus:rpl-13 60S ribosomal p
rotein L13 status:Confirmed
UniProt:P91128 protein_id:
CCD66399.1
SGDYDL082W5.002276765025871e-34RPL13A Protein component of th
e large (60S) ribosomal subuni
t, nearly identical to Rpl13Bp
; not essential for viability;
has similarity to rat L13 rib
osomal protein
Stentor CoeruleusSteCoe_231922.1151310375910805e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00578640(protein)
MKHNNQLPVAQLRKHQQFRIKTFFNQAAQKKARLHARRAQAAAVFPRPTEKLQPVVRKQT
QRYNKSTKLGRGFTLQELKAAGISAAFAQSIGIKVDHRRKNRCQESLELNKKRLLAYVSK
LVLFPRHQGKAKKGLVNDTADTSSAAQNALQTSVPLPSVSKREKAVSNIAELRKKKVYRI
IRQEKTNQKWDGKRKAKAQAAAEPKA


>TTHERM_00578640(coding)
ATGAAGCACAACAATCAATTACCCGTTGCCTAATTAAGAAAGCATTAATAATTCAGAATT
AAAACTTTCTTCAACCAAGCTGCCTAAAAGAAGGCTAGATTACATGCCAGAAGAGCTTAA
GCCGCCGCTGTCTTCCCCAGACCTACTGAAAAGTTACAACCTGTTGTTAGAAAGCAAACC
CAAAGATACAACAAGTCCACCAAGCTCGGAAGAGGTTTCACCTTACAAGAATTGAAGGCT
GCCGGTATCTCTGCCGCTTTTGCCTAATCTATTGGTATCAAGGTTGACCACAGAAGAAAG
AACAGATGTCAAGAATCTCTTGAATTAAACAAGAAGAGACTTTTGGCTTACGTTAGCAAG
CTCGTTCTCTTCCCTAGACACTAAGGTAAGGCCAAGAAGGGTTTAGTTAATGACACCGCT
GACACCAGCAGTGCTGCTCAAAACGCCTTATAAACCTCTGTTCCTCTTCCCTCTGTCTCC
AAGAGAGAAAAGGCTGTTTCCAACATCGCTGAACTCAGAAAGAAGAAGGTTTACAGAATC
ATCAGACAAGAAAAGACCAACCAAAAGTGGGATGGAAAGAGAAAGGCTAAAGCTCAAGCT
GCCGCTGAACCCAAGGCATGA


>TTHERM_00578640(gene)
ATGAAGCACAACAATCAATTACCCGTTGCCTAATTAAGAAAGCATTAATAATTCAGAATT
AAAACTTTCTTCAACCAAGCTGCCTAAAAGAAGGCTAGATTACATGCCAGAAGAGCTTAA
GCCGCCGCTGTCTTCCCCAGACCTACTGAAAAGTTACAACCTGTTGTTAGAAAGCAAACC
CAAAGGTGAATATCTATCATTCAATCCAAATTAAATCACAAACCGATCACCATTTTTTTC
TTAAAAATTATTGATTCAAAATACAAATATGCATTTTACTTTTTCATTTTACAATTTCCA
TCGAACTCTAAAAGATGGGACAGCTTCCCATGCAATTGTATTTTTTTACAGTTCGTTTTA
ACCAAATAAATGCTGGTCAATCGCTCAGTCAATAAATCAATCAATTAAAGAGTCAATTAA
ATAAAAAAATCACTAGAATTAGGGTAACTTAATCGAATAGATATTTCATTCTTAAGTTAG
CAGATGAATTTAAAATTGTAATAGAAATATAATTAAATGCGGAATACTTTTTAACAAAAT
GGAATTCAATCATAACCTGTATTGCGGAAATCTAGTAAAGTAGATTTAGCTTCTGATTTA
TCTGATTGTTAGATTTGAAATATCATCAGCCTTTAATTAGGTTTTAACTAAATAAATGTA
AATAACACAATTTAGGTATTCTAAAACTTCTCAATAAAGAATATAATCAGTAGACATTAT
GCCAACATATTTAGCAAAGAATATAAAAGCAATTTATGTATACAGTAGATCGATTAATTG
ATTAGGTAGGGAGTCTTAGCGTCAATCAAAGATCAAGTAGATCATTTGGTTTCTAATAAA
TTTAAGCAAGCTAAATTATAAAATATCTAAATACAAATTTAAAAAGACGAAATTATCAAA
ACTCATAAATGAATGATGATGAAATAATTTAAATAGAGCAACTTGTAATATTTGTTCAAT
GAAAAAAAAATATGCAAAATAAAGCCGCCAAATATTTAAAAATTTAGGCATGTTAGGGTA
CATTAAATACTCATTTATCAAAACTCAAATAAACCTTATTGATTGAATGAAATAATTACT
TGCATAATAATTAAAATTGATTGATTCATGATAATGACTGTTTAATTGATTGATTGAAGC
TGAAATATTTAGGAATTGAATATAATTGTAAAAACAATTTAAATTCTACAAAAAAGTTTA
ATAAGGTTAAAACTAAAAGTAAATATAATCCATTCATTTAAAGTTTAATCTTTAAATTAA
GTGAAATCATGCATATTATTTTTGAATGCTTTACAAAATTAAATCGCAATAAAAATAAGA
ATAAAAATAAATACTGATTGGTTTAAACTTCAATTATTTATTAATAAATTTTACTCATCT
ATTTTCTATTAAATTTAGATACAACAAGTCCACCAAGCTCGGAAGAGGTTTCACCTTACA
AGAATTGAAGGCTGCCGGTATCTCTGCCGCTTTTGCCTAATCTATTGGTATCAAGGTTGA
CCACAGAAGAAAGAACAGATGTCAAGAATCTCTTGAATTAAACAAGAAGAGACTTTTGGC
TTACGTTAGCAAGCTCGTTCTCTTCCCTAGGTAAATAAAGAAACATTAATAAATTTTATT
AGCAAATATAAAGAAATAGGCATAGTATTTTTGTATATATCATTTAAATACCTTCAAATA
ATTTACAAGTTAAGCAATTAGATTATGAATTTTAATCTAAAAATTTTAACTTACTTACCA
TTTTATTTGATTTGTATTTTAACTGAGCAAAAATACTTACTGAATATATATATATATATT
TATATGCAAACTAGCCTAAAGATATTTGCAAGAAATTAATATCTGTAATATGGCAATTTC
TTATCTTTATTTTTAATAAAAATAGACACTAAGGTAAGGCCAAGAAGGGTTTAGTTAATG
ACACCGCTGACACCAGCAGTGCTGCTCAAAACGCCTTATAAACCTCTGTTCCTCTTCCCT
CTGTCTCCAAGAGAGAAAAGGCTGTTTCCAACATCGCTGAACTCAGAAAGAAGAAGGTTT
ACAGAATCATCAGACAAGAAAAGACCAACCAAAAGTGGGATGGAAAGAGAAAGGCTAAAG
CTCAAGCTGCCGCTGAACCCAAGGCATGA