Identifiers and Description

Gene Model Identifier

TTHERM_00028740

Standard Name

RPL12 (Ribosomal Protein of the Large subunit #12)

Aliases

PreTt14204 | 2.m02033 | 3825.m02597

Description

Homolog of Yeast RPL12, Human RPL12, Bacterial RPL11; Ribosomal protein L11; RNA binding domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00028740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00774.17.998584418911683e-103ribosomal protein L11, RNA bin
ding domain-containing protein
(165 aa)
SGDYEL054C1.0000099287337047e-53RPL12A Protein component of th
e large (60S) ribosomal subuni
t, nearly identical to Rpl12Bp
; rpl12a rpl12b double mutant
exhibits slow growth and slow
translation; has similarity to
E. coli L11 and rat L12 ribos
omal proteins
WormBaseWBGene000044244.000521932330652e-52locus:rpl-12 60S ribosomal p
rotein L12 status:Confirmed
UniProt:P61866 protein_id:
CAB05226.1
DictyBaseDDB_G02882953.00039543526891e-44rpl12 on chromosome: 5 positio
n 1359447 to 1360234
OxytrichaContig10133.0.0.g1017.00174216458014e-43hypothetical protein
Stentor CoeruleusSteCoe_135371.9287498479639178e-22

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00028740(coding)
ATGCCTCCTAAAGTCGACCCCAACGAAGTTAGATTCATTAACATTAAGGTTTTCGGTGGT
GAACCCGGTCCCGCTTCTACCTTGGCCCCCAAGCTCGGTCCTCTCGGTTTGAACGCTAAG
AAGGTCGGTGAAGATATCATTGCTGCTTGCAACCAACACAAGGGTATCAGAGTTATGATC
CAACTCAAGTGCCAAAACAGAGCTGCTCAAGTTACCGTCGTTAACACCTCTTCCGCTCTT
ATCATCAAGGAACTCGGTAAGCACGTCAGAGATAGAAAGAAAACTAAGGGTATCAAGCAC
TCTGGTGACCTCAGTTTGGAACAAATCAAGAAGATCGCCAAGATTATGTAAGACGAAAAC
AAGAGTTTCGCCAAGACCTTCGCTGGTACTGTTAAGTCCGTCCTCGGTACTGCCCAATCT
ATCGGTATCACCGTTAACAAGTTACACCCCAAGAAGGTCATTGAATAAATCAACAAGGAA
GAAATTAAGATTTGA


>TTHERM_00028740(protein)
MPPKVDPNEVRFINIKVFGGEPGPASTLAPKLGPLGLNAKKVGEDIIAACNQHKGIRVMI
QLKCQNRAAQVTVVNTSSALIIKELGKHVRDRKKTKGIKHSGDLSLEQIKKIAKIMQDEN
KSFAKTFAGTVKSVLGTAQSIGITVNKLHPKKVIEQINKEEIKI


>TTHERM_00028740(gene)
ATGCCTCCTAAAGTCGACCCCAACGAAGTTAGATTCAGTATGGCTTTTCTTCAATAATTT
TTTTTCTTAATGTTATTTATCAAAGCGCATCCTAATTTTTGTTAGTGATAGCAACTTCTA
AGCAAATGCCGCCATATACAGACAGAGATTGGTTGATTTATCAATCAATTATTAATGAAT
TTACTTCATAACATTATTTTTTCCCATCTCAAAAATAAACGATAATTTAGTTAATAATAT
TTCTAATCCATCGTTTTCATATAAAATGGTTCTGACAAATAAACTTCTTAACAACTATCA
AGATTAATTTAGATTCAAAGCTAATAAAGATGAACCCAAAATGATTAATTAACCTCTTAA
TTTTGCTCTTCCTTCTAAAATATCTAAATAATGATATAAACAAACAAAGGTACAAGCATA
ATGATGAAAAGCATTACTAACTAGCAAAAGAAATATTTAAATATAATTAAATTTAACTAA
ATTTTCATTAATAATAATCGCATACTCATAGATAGAATCAATATTAAAAAGCAAGTATAA
AAAATTAGCTAATAAGAAAACTCAGCATGATTCAAAATGAGATCTATTTATCATTCGATA
TACTTTGCCATTTAATACATAAACAACACTCTCTCAAATGATTGCAATTATTGAAAAAAA
GTTAATCAAGCATAGAAAATAAATTTAAAATAAAAGCTTTTGCTAGTAAATTATAATGGC
AGTTGTTAGTAGCAGTAGTTTTAGTAAATAAAAAGCCAAAAATAAATTAGCATAGCTAAC
TATTCAATTGTTTTAACTTTAATTATTTTCTTAGTGTAAAAAAATAAAGAAGCAGAAAAG
TAGATAGATTGATCGATCGATTTTTAAATGCAAAGTATAAAATCGATTTTATCAAAAAAA
AAGAAGTTGAAAATAATTAATATCAAAATTATGTATGGATGAATGGATTAGAAATATTTT
ATTTAAATTATCATGACTACCTTTGATTAAATGTGGCTCAAATAAAATTTTATATTCTAC
TAAATTAATATCAAAAGAGTCTAAACTTTTTTGATAAATAACAAAATAACTTTTTATTTG
AATGCAGTTATTAATATCATATTCTAATAAATAGTTAACATTAAGGTTTTCGGTGGTGAA
CCCGGTCCCGCTTCTACCTTGGCCCCCAAGCTCGGTCCTCTCGGTTTGAACGCTAAGAAG
GTCGGTGAAGATATCATTGCTGCTTGCAACCAACACAAGGGTATCAGAGTTATGATCCAA
CTCAAGTGCCAAAACAGAGCTGCTCAAGTTACCGTCGTTAACACCTCTTCCGCTCTTATC
ATCAAGGAACTCGGTAAGCACGTCAGAGATAGAAAGAAAACTAAGGGTATCAAGCACTCT
GGTGACCTCAGTTTGGAACAAATCAAGAAGATCGCCAAGATTATGTAAGACGAAAACAAG
AGTTTCGCCAAGACCTTCGCTGGTACTGTTAAGTCCGTCCTCGGTACTGCGTAAGAAATT
TAAACATTTTAACATTAGAATTATATATAGTTGCAATCCTTTTTTAAAGAAATAAAATAA
TAAAAAACAAAAATTAAAATAATTTTTAAATTAATTAAATAGCCAATCTATCGGTATCAC
CGTTAACAAGTTACACCCCAAGAAGGTCATTGAATAAATCAACAAGGAAGAAATTAAGAT
TTGA