Identifiers and Description

Gene Model Identifier

TTHERM_00829380

Standard Name

RPL11 (Ribosomal protein of the large subunit)

Aliases

PreTt14117 | PreTt14116 | 144.m00135 | RPL5-E.coli

Description

Homolog of yeast RPL11(/RPL5)and E.coli RPL5

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00281 ) ribosomal protein L5
  • ( PF00673 ) ribosomal L5P family C-terminus

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.2%

TetraMine Data

TTHERM_00829380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10203.14.9996115996408327e-11060S ribosomal protein L11 (173
aa)
OxytrichaContig19511.0.g1192.0008312485874125e-83ribosomal L5P family C-terminu
s
SGDYGR085C1.9996609186508915e-82RPL11B Protein component of th
e large (60S) ribosomal subuni
t, nearly identical to Rpl11Ap
; involved in ribosomal assemb
ly; depletion causes degradati
on of proteins and RNA of the
60S subunit; has similarity to
E. coli L5 and rat L11
WormBaseWBGene000044238.997777707990486e-82locus:rpl-11.2 status:Confir
med UniProt:Q19162 protein
_id:CCD61193.1
DictyBaseDDB_G02791899.998074580622396e-81rpl11 on chromosome: 3 positio
n 1766422 to 1767386
Stentor CoeruleusSteCoe_235881.2160992992528256e-37

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00829380(coding)
ATGACCGACAAAAAGGAAAATAAGATGAGAGAAGTCAAGATCGCCAAGTTGGTTATCAAC
TGTTGCGTTGGTGAATCTGGTGATAAGCTTACCAAGGCTGCTAAGGTCTTGAAGGATTTA
TCCGGACAAGAACCCGTCTTCTCCAGAGCTAGATACACCATCAGATCCTTCGGTATCAAG
AGAAACGAAAAGATGGCTGTTCACGTTACCATCAGAGGTGATAAGGCCAGAGATATCCTT
ACCAGAGGTTTAAAGGTTAAGGAAATGGAACTTAGAAAGAAGAACTTCTCCAACACTGGT
AACTTCGGTTTCGGTATCTAAGAACACATCGATCTCGGTATGAAATATGACCCCTCTACT
GGTATTTTCGGTATGGACTTCTACGTCGTCCTTGAAAGACCCGGTACAAGAGTTGCTAGA
AGAAGAAGAGCTACCTCTAGAGTCGGTAACAACCAAATGATCTCCAAGGAAGAATGTATC
AACTGGTTCAAGACCGAATTCGAAGGCAACGTCTATTGA


>TTHERM_00829380(protein)
MTDKKENKMREVKIAKLVINCCVGESGDKLTKAAKVLKDLSGQEPVFSRARYTIRSFGIK
RNEKMAVHVTIRGDKARDILTRGLKVKEMELRKKNFSNTGNFGFGIQEHIDLGMKYDPST
GIFGMDFYVVLERPGTRVARRRRATSRVGNNQMISKEECINWFKTEFEGNVY


>TTHERM_00829380(gene)
ATGACCGACAAAAAGGAAAATAAGATGAGAGAAGTCAAGATCGCCAAGTTGGTTATCAAC
TGTTGCGTTGGTGAATCTGGTGATAAGCTTACCAAGGCTGCTAAGGTCTTGAAGGATTTA
TCCGGACAAGAACCCGTCTTCTCCAGAGCTAGATACACCATCAGATCCTTCGGTATCAAG
AGAAACGAAAAGATGGCTGTTCACGTTACCATCAGAGGTGATAAGGCCAGAGATATCCTT
ACCAGAGGTTTAAAGGTTAAGGAAATGGAACTTAGAAAGAAGAACTTCTCCAACACTGGT
AATTTGTTAATCTTGTTTTTTTTCTGATAAATGCTTTTTTTCAGCTTCTTTCTTCTTTGT
TCTCCTGCAGCTAATAATCAATTATTCATTGATTCAAAGCATTTTGCTTAAAGCAAGATT
CCTTAAGAAAGCTCTTTTTATTTATTTCAATCTCAATAATTTCAACGGCTTAATTAATAT
TTATTTTTAAAACAGGTAACTTCGGTTTCGGTATCTAAGAACACATCGATCTCGGTATGA
AATATGACCCCTCTACGTAAGCTATTAACACAAACTCAAAAAAACAATCTTTTAAATTCG
TAGCATCTGCAAAGCTCACAAAAATAAATCAAGACAAAAATGCCCTAAAACAAAAAAAAG
CAATATAAAAAAGAAGCATCAAATATACAGCGAGTTTTTAAAGATTAAAAATGCAGTCTT
TAATTAAAAATTCATAATAAAATCAATATGATTTTCACTTAAAGCCTTGAAGATGCTGCA
ATTTAAAAATGAAATTTTCCTATTAAACATTAAAATAATCTTTCCTTTTAATTAATAATA
GTGGTATTTTCGGTATGGACTTCTACGTCGTCCTTGAAAGACCCGGTACAAGAGTTGCTA
GAAGAAGAAGAGCTACCTCTAGAGTCGGTAAGAGATCAATTACTTTTTAAATTGAATAAG
TTTAAATACTTCAATCTTATTTACTTCACATGCACGCCAATCAGCTTTCCTTCAAACTAT
CTATCTATCTATTAATAAATAAATAAACTGCTAAGATTAAAGATAATAAATAAATAAATA
AATAAATAAATAAAAGCTCAAAGAATAATACGAATAGTTAATCTAATAAAGTCAATAAAT
CTCATAGCAATTATTAAATTAAAGGACAAAAAAAAGTTGTTTATTTGAAGGATATGCATA
AAGTTTAGATGATAAAATTAGCTAAAAAACCAATAGAAAGTCTTAAAATTAAGCTCAACT
TGTAATTAAAATCTTTGTTTGCGTTTTCTAGCACTTTTGTGTTAAGAAATAAGGACTTTT
CTTGAAGTGAAATGGAAATTACTAACTCTACTATTATGCAGTCAAAACAATTTAAAATAA
TGCTAATATGAAAAATGAAACTATCCATTCAATATAGCAATTTTCATTAATTTAGTGAAT
CAAACAAAATAATTAATAAAATTAATAAGTGGTTCTTTTCGGATTTAAAAACCAACAAAT
CAATCAATGGTAAATTTATTGTTTTTTGGTTGGTTGGTTTGTTTGTTTGTTATGAGGCTG
ACTTAAAACGAAATTAGATTTAAACCTTTGAAAAATAAAAAGAATGATTGAATTTATATT
GCCTTAACTATTTGGGTTACGAGAATACTTAAGGAATAAATTAATGTGTTAAATAAAGAG
ATAGTTAGATGGATAAACTGTTTTGTAAGCTGTTAGAGAAATTTGGTAGCAGAAATAAGA
ACGATGCTTGCATAGAAATAAATTAGATTGGAATTTTTATACTTACTTTAACCTTTTTTT
GATATAATTAACTAATCAATTAATTAAATTATTAGGTAACAACCAAATGATCTCCAAGGA
AGAATGTATCAACTGGTTCAAGACCGAATTCGAAGGCAACGTCTATTGA