Identifiers and Description

Gene Model Identifier

TTHERM_01053000

Standard Name

RPL10 (Ribosomal protein of the large subunit)

Aliases

PreTt22023 | 213.m00073 | RPL16-E.coli

Description

Ribosomal protein L10.e containing protein; Homolog of yeast RPL10(/RPL16) and E.coli RPL16

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01053000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09424.11.0001788721085356e-149ribosomal protein L10.e contai
ning protein (216 aa)
OxytrichaContig10707.0.g223.0014466598835893e-101Ribosomal protein L16p/L10e
DictyBaseDDB_G02882736.997716170296885e-95rpl10 on chromosome: 5 positio
n 1312496 to 1313528
WormBaseWBGene000044211.99970314379378e-94locus:rpl-10 60S ribosomal p
rotein L10 status:Confirmed
UniProt:Q09533 protein_id:
CAA88308.1
SGDYLR075W9.998285701479858e-93RPL10 Protein component of the
large (60S) ribosomal subunit
, responsible for joining the
40S and 60S subunits; regulate
s translation initiation; has
similarity to rat L10 ribosoma
l protein and to members of th
e QM gene family
Stentor CoeruleusSteCoe_305826.813556821545298e-46

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_01053000(coding)
ATGGGTAGAAGACCTGCTAGATGCTACAGATAACCTAAGGGTAAGCCTTATCCCAAGTCC
AGATACAACAGAGGTGTCCCCGATGCCAGAATCAGAATCTACGACTCTGGTAGAAAGAAA
GCCACCGTTGAAGAATTCCCTTACGTTGTTCACATCGTTTCTGATGAAAAGGAATAAATC
ACCTCTGAAGCCTTGGAAGCTGCCCGTATTGCTGCTAACAAAAATTTGATTAAATTCATC
TCTAAGGATGCTTTCCATTTAAGATGCAGAGTCCACCCCTGGCACGTACTCAGAATTAAC
AAGATGTTGTCTTGTGCTGGTGCTGATAGACTCCAATCTGGTATGAGAGGTGCTTTCGGT
AAGGCTTTGGGTAAGGCTGCTCGTGTTGATATTGGCTCTATTCTTTTCTCCGTCAGAGTC
AAGGAACCTCACGTTAAGTATGCCATCGACGCTCTTACTAGAGCTAAGGCTAAATTCCCT
GGTAGACAAAAAGTCGTCACCTCCCAAAAGTGGGGTTTCACCAAGCTTACCAGAGCTTAA
TACTCCAGACTTAGAAACCAAAAGAAGCTCGTTACTGATGGTTCCAATGTTAAAGTTATT
GGTGAAAGAGGTCCCCTCTCCAGACTTGAACTCTTCAGAAAGATCTGA


>TTHERM_01053000(protein)
MGRRPARCYRQPKGKPYPKSRYNRGVPDARIRIYDSGRKKATVEEFPYVVHIVSDEKEQI
TSEALEAARIAANKNLIKFISKDAFHLRCRVHPWHVLRINKMLSCAGADRLQSGMRGAFG
KALGKAARVDIGSILFSVRVKEPHVKYAIDALTRAKAKFPGRQKVVTSQKWGFTKLTRAQ
YSRLRNQKKLVTDGSNVKVIGERGPLSRLELFRKI


>TTHERM_01053000(gene)
ATGGGTAGAAGACCTGCTAGATGCTACAGATAACCTAAGGGTAAGCCTTATCCCAAGTCC
AGATACAACAGAGGTGTCCCCGATGCCAGAATCAGAATCTACGACTCTGGTAGAAAGAAA
GCCACCGTTGAAGAATTCCCTTACGTTGTTCACATCGTTTCTGATGAAAAGGAATAAATC
ACCTCTGAAGCCTTGGAAGCTGCCCGTATTGCTGCTAACAAAAATTTGATTAAATTCATC
TCTAAGGATGCTTTCCATTTAAGATGCAGAGTCCACCCCTGGCACGTACTCAGAATTAAC
AAGATGTTGTCTTGTGCTGGTGCTGATAGACTCCAATCTGGTATGAGAGGTGCTTTCGGT
AAGGCTTTGGGTAAGGCTGCTCGTGTTGATATTGGCTCTATTCTTTTCTCCGTCAGAGTC
AAGGAACCTCACGTTAAGTATGCCATCGACGCTCTTACTAGAGCTAAGGCTAAATTCCCT
GGTAGACAAAAAGTCGTCACCTCCCAAAAGTGGGGTTTCACCAAGCTTACCAGAGCTTAA
TACTCCAGACTTAGAAACCAAAAGAAGCTCGTTACTGATGGTTCCAATGTTAAAGTTATT
GGTGAAAGAGGTCCCCTCTCCAGACTTGAACTCTTCAGAAAGATCTGA