Identifiers and Description

Gene Model Identifier

TTHERM_00492730

Standard Name

RPE1 (Ribulose 5-Phosphate Epimerase)

Aliases

PreTt04209 | 61.m00196 | 3711.m00044

Description

ribulose-phosphate 3-epimerase family protein; catalyzes a reaction in the non-oxidative part of the pentose-phosphate pathway

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01163 ) ribulose-phosphate 3-epimerase
  • ( TIGR03128 ) 3-hexulose-6-phosphate synthase
  • ( PF00834 ) ribulose-phosphate 3 epimerase family protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 22.4%

TetraMine Data

TTHERM_00492730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12969.16.998828886836733e-138ribulose-phosphate 3-epimerase
(228 aa)
WormBaseWBGene000172724.9994004612166366e-86Ribulose-phosphate 3-epimerase
status:Confirmed UniProt:
Q95ZW2 protein_id:CCD69064.1
SGDYJL121C2.0000012618802033e-84RPE1 D-ribulose-5-phosphate 3-
epimerase, catalyzes a reactio
n in the non-oxidative part of
the pentose-phosphate pathway
; mutants are sensitive to oxi
dative stress
DictyBaseDDB_G02782757.002185723491005e-79rpe on chromosome: 3 position
603034 to 603814
Stentor CoeruleusSteCoe_382901.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00492730(coding)
ATGTCTGAAAAACAATTATAGGCTATTATAGCTCCTTCAATTTTATCAGCTGATCTTTCA
AGCCTTGCTGATGAATGTTAAAAGCTTAATGACTAAGGCGCAGATTGGTTACATATTGAT
GTCATGGATGGCCACTTTGTCCCAAACTTCACTTTTGGTTAAACTGTTGTTAAGTGCCTC
AGAAAGAAAGTCAAAGGATTTTTTGATTGCCATTTAATGATTTCTGAACCCTAAAAATGG
GTTAAAGATTTCCATAATGCAGGAGCAGATCAATATACATTCCATTACGAAGCTGTTGAA
AATCAAGAGTAGCTCTGCAAAGAAATCAAGGAAACTGGAATGAGGGTAGGAATTGCTATT
AAACCAAAAACTTAAATCGAAGATAAACTTTTACAACTTATTGATAGTAATTTAGTTGAC
ATGGTTTTAATTATGACAGTAGAACCTGGTTTTGGTGGATAAAAGTTTATGTAAGACATG
ATGTAAAAAGTTGAGCTTTTAAGAAGAAAATATCCTAAGCTAGATATTTAGGTTGATGGA
GGTATAGTATGTGAAAACATCGATATAGTTGCTAAAGCTGGAGCAAATGTTATTGTCTCA
GGTTCAGGTATAGTAAATCATGCTGATCCTAAAAAAGCTATGGCTTTTATGAAAGAAAGA
GTTTAGTTTTTTATTTCTGACAATGAAAATCAAATTTAATAGTAAAAGGATTGA


>TTHERM_00492730(protein)
MSEKQLQAIIAPSILSADLSSLADECQKLNDQGADWLHIDVMDGHFVPNFTFGQTVVKCL
RKKVKGFFDCHLMISEPQKWVKDFHNAGADQYTFHYEAVENQEQLCKEIKETGMRVGIAI
KPKTQIEDKLLQLIDSNLVDMVLIMTVEPGFGGQKFMQDMMQKVELLRRKYPKLDIQVDG
GIVCENIDIVAKAGANVIVSGSGIVNHADPKKAMAFMKERVQFFISDNENQIQQQKD


>TTHERM_00492730(gene)
ATGTCTGAAAAACAATTATAGGCTATTATAGCTCCTTCAATTTTATCAGCTGATCTTTCA
AGCCTTGCTGATGAATGTTAAAAGCTTAATGACTAAGGCGCAGATTGGTTACATATTGAT
GTCATGGTACTTAAAATTACTTGTGCTTTCATAATTTTTTAATAATTTATTTAATTAATA
GGATGGGTAAATAGTTTTATAGTTTTCATAATAGAATTCTAGCAAGAAATGAATGAACAA
ATAGATTGAATAATTCAATAAATTTATATTAAATACAATTATTTTTTAAATTAGCCACTT
TGTCCCAAACTTCACTTTTGGTTAAACTGTTGTTAAGTGCCTCAGAAAGAAAGTCAAAGG
ATTTTTTGATTGCCATTTAATGATTTCTGAACCCTAAAAATGGGTTAAAGATTTCCATAA
TGCAGGAGCAGATCAATATACATTCCATTACGAAGCTGTTGGTATAGCATTAAATATAAT
TCAAGGCTAATTGGTCAATAATAATAATTTTTTAAATAGAAAATCAAGAGTAGCTCTGCA
AAGAAATCAAGGAAACTGGAATGAGGGTAGGAATTGCTATTAAACCAAAAACTTAAATCG
AAGATAAACTTTTACAACTTATTGATAGTAATTTAGTTGACATGGTTTTAATTATGACAG
TAGGTAATATCACTAAAAAAATAAAATTCATATCTTTTAAACAATATTTAATTTTTTTTA
GAACCTGGTTTTGGTGGATAAAAGTTTATGTAAGACATGATGTAAAAAGTTGAGCTTTTA
AGAAGAAAATATCCTAAGCTAGATATTTAGGTTGATGGAGGTATAGTATGTGAAAACATC
GATATAGTTGCTAAAGCTGGAGCAAATGTTATTGTCTCAGGTTCAGGTATAGTAAATCAT
GCTGATCCTAAAAAAGCTATGGCTTTTATGAAAGAAAGAGTTTAGTTTTTTATTTCTGAC
AATGAAAATCAAATTTAATAGTAAAAGGATTGA