Identifiers and Description

Gene Model Identifier

TTHERM_00094210

Standard Name

RPC5 (RNA polymerases I and III subunit 5)

Aliases

PreTt16576 | 6.m00650 | 3836.m02233

Description

Fifth largest subunit of RNA polymerases I and III; homolog of RPC40 in yeasts and RPA40 in humans; expressed in macronucleus of vegetative cells and weakly in early stages of conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01193 ) RNA polymerase Rpb3/Rpb11 dimerisation domain
  • ( PF01000 ) DNA-directed RNA polymerase, alpha subunit,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00094210

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02582.19.997093137033517e-262DNA-directed RNA polymerase I
polypeptide (340 aa)
OxytrichaContig22041.0.g309.995094197784295e-101RNA polymerase Rpb3/RpoA inser
t domain
DictyBaseDDB_G02823398.003693242657371e-87rpa5 on chromosome: 3 position
5656917 to 5658092
WormBaseWBGene000192752.0004485223439647e-69locus:rpac-40 status:Confirm
ed UniProt:Q9UAY9 protein_
id:CCD68663.1
SGDYPR110C3.0000115468388957e-66RPC40 RNA polymerase subunit A
C40, common to RNA polymerase
I and III
Stentor CoeruleusSteCoe_75223.0144087850653746e-40

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15470252: Mochizuki K, Gorovsky MA (2004) RNA polymerase II localizes in Tetrahymena thermophila meiotic micronuclei when micronuclear transcription associated with genome rearrangement occurs. Eukaryotic cell 3(5):1233-40

Sequences

>TTHERM_00094210(coding)
ATGTCAAATAAAACTTAAAAAATGAAGAAAAATATTGTCTTCACCAACGAAGGCATTCAA
CACAGCTAGGAAATGAACTATAGCGCTGCTTTTACTAGTGAAGAAGATTTCAATACATTC
AAGGAAAACATTAAAATAGAAGTTATTAGATATGATAATAAAAATAAAGAATTAGAATTT
GATTTAATGGGTGTCGATGCTCCTATTGCTAACGCTTTGAGAAGAATTATGATTGCAGAA
GTTCCTACAATGGCTATCCACAAGGTTTATATTTACTAAAATACTTCTATTATTCCTGAT
GAAGTTTTGGCTCACAGACTTGGTTTAATTCCTATTTATGCTGACCCTCGTCTTTTCGAA
GAAAAGCAAGAAGAAGACGAGTATAATGAAAAAAATTCTTTAAAGTTTACATTAAAGATT
AAATGCTCTAAGAAAGAATAGTACAAAAATTACTCTGAAGCTGATTTAGAAAATTTAACA
CCTGAAACCTACTTAGAAAATGCTATTGTCTATAGCGGTGATTTCAAATGGGTTTCTTAA
GGAGAATAAAATAAAAAATTTGAAGAGAATCCAATCAGAATGGTCCATGATAATATTATT
GTAGCTAAGTTAAGAGAAAACCAAGAAATTATTTGTGAAGTTATTTGTTAAAAGGGTATT
GGAAAAACACATGCCAAATGGTCTCCTGTTTGTACTGCTTACTATCGTTTAATGCCTGAA
ATAAACATAAATAGTGATATCACCGGAGCTAAAGCTCAAGAATTGAAAGAACGTTGCCCT
CTTAAAGTTTATGATGTTTAAAATAATAAGGCTATTGTTTCTAACGAAAGAGCTTGCACT
ATGTGCAGAGAATGCATAAGAGAAGATGAAGAATTCAATTCAAAGATTGAATTGGCCAAA
AAGAAAGAGCATTTTATTTTTACTGTAGAAAGCGTTGGAATCTACGAACCTCACGAGATA
GTAAAGGAAGCAATCTAGATATTAAAATAAAAAGCATCTAGTTTTATGCTAAACCTATGA


>TTHERM_00094210(protein)
MSNKTQKMKKNIVFTNEGIQHSQEMNYSAAFTSEEDFNTFKENIKIEVIRYDNKNKELEF
DLMGVDAPIANALRRIMIAEVPTMAIHKVYIYQNTSIIPDEVLAHRLGLIPIYADPRLFE
EKQEEDEYNEKNSLKFTLKIKCSKKEQYKNYSEADLENLTPETYLENAIVYSGDFKWVSQ
GEQNKKFEENPIRMVHDNIIVAKLRENQEIICEVICQKGIGKTHAKWSPVCTAYYRLMPE
ININSDITGAKAQELKERCPLKVYDVQNNKAIVSNERACTMCRECIREDEEFNSKIELAK
KKEHFIFTVESVGIYEPHEIVKEAIQILKQKASSFMLNL


>TTHERM_00094210(gene)
TTAAATTTGTCTTTAAGTTAAAAAATAAAGAGCAATAAAAAAGATTTTTAAATAATAAAA
ACTTTTAAGTAGTAGAATACAAAATATATAGCTAACTAATATTAAAATATGTCAAATAAA
ACTTAAAAAATGAAGAAAAATATTGTCTTCACCAACGAAGGCATTCAACACGTATAGATT
AAAAATCATTTTTTTATTTTAAATAAAAGTGTTCAAAGAACTAAGCAATTTTAGCCAATT
TCATCATATTTACTAAATTAGAATCTTTAATGAAGTATTTAATCAGGAAATCTAAAAAAT
GATTTCTAAATTTGATGAATTAGAAAATGAATTAACAAATTTAATCAAATAAAAATTCTA
TATCAAATTTAAATGAGCTTAAACATATTTTATCTTATCAAAAGAGCTAGGAAATGAACT
ATAGCGCTGCTTTTACTAGTGAAGAAGATTTCAATACATTCAAGGAAAACATTAAAATAG
AAGTTATTAGATATGATAATAAAAATAAAGAATTAGAATTTGATTTAATGGGTGTCGATG
CTCCTATTGCTAACGCTTTGAGAAGAATTATGATTGCAGAAGTATATTATTTTTCTTTTT
TTCAAATTTTTAGTTTTCTTGAGCGAAAATTATCATTAGTTTCTAAAATACTATTAAAAA
TTAATAGGTTCCTACAATGGCTATCCACAAGGTTTATATTTACTAAAATACTTCTATTAT
TCCTGATGAAGTTTTGGCTCACAGACTTGGTTTAATTCCTATTTATGCTGACCCTCGTCT
TTTCGAAGAAAAGCAAGGTAAATTCATTTTATAAAATTAAAGAAGAAGATTTATTTATAA
ACAAGATTTTATAGCAATAAAAAAGTAAAGTGGATAGATAGCTAAATTAATTAATTCTTA
ATTTTTATATAAATTATTTTATTTACTGCTTTTGAATTTAATAATAATCAAATTTTAAAT
AATAAATTTAGAAGAAGACGAGTATAATGAAAAAAATTCTTTAAAGTTTACATTAAAGAT
TAAATGCTCTAAGAAAGAATAGTACAAAAATTACTCTGAAGCTGATTTAGAAAATTTAAC
ACCTGAAACCTACTTAGAAAATGCTATTGTAAGATAAATTTTTTGATTTAGGAAGCGAAT
TTTTAAATGATCTAATACATTTTAATTAGGTCTATAGCGGTGATTTCAAATGGGTTTCTT
AAGGAGAATAAAATAAAAAATTTGAAGAGAATCCAATCAGAATGGTCCATGATAATATTA
TTGTAGCTAAGTTAAGAGAAAACCAAGAAATTATTTGTGAAGTTATTTGTTAAAAGGGTA
TTGGAAAAACACATGCCAAATGGTCTCCTGTTTGTACTGCTTACTATCGTTTAATGCCTG
AAATAAACATAAATAGTGATATCACCGGAGCTAAAGCTCAAGAATTGAAAGAACGTTGCC
CTCTTAAAGTTTATGATGTTTAAAGTAATTTAAAATAATTAATATTAAATTAACATCAGC
TAATATAAATAAAACTATCTATTTTAATAGATATTTAATATTTTTTATTATTCTGTAAAC
AAATACCAAACAAGTATCAAGTCAATTTCTGATAACTAAAAATTGATTTCTTGCTAAATT
ATAATTATCAAAAAATTACTTGTTTGTTAGATATAAATAAAAAGACACAGCTAATACAAA
TCAAATATTAATTATATTCTAAAATTTATTGGTCTAAAATTATGATCTAAAAAAAATATC
TAAGACTTTATATAGCTTAAAAAATTTTTTGTTTACTTAAATTAAATTAATTTTTATAAA
TAGATAATAAGGCTATTGTTTCTAACGAAAGAGCTTGCACTATGTGCAGAGAATGCATAA
GAGAAGATGAAGAATTCAATTCAAAGATTGAATTGGCCAAAAAGAAAGAGCATTTTATTT
GTAAAATATTCATTATATTTAGATTAAATTGATAGGAATTTATATAAGAAATAATAATTT
TACTGATCGGAAAGGGAAGATATAGAAAAATTAATTAATTTGGATTTAAGCTAATTTAAT
ATATTTATTAGTTAAAATTACAATAATTACCTTATATTAATTTATATTTTTAATATGCAA
ATAGTTACTGTAGAAAGCGTTGGAATCTACGAACCTCACGAGATAGTAAAGGAAGCAATC
TAGATATTAAAATAAAAAGCATCTAGTTTTATGCTAAACCTATGAGATAGATAGATAGAT
TTACAAATATTAGTTATATGATTTAATAATAAATCATTGAATATTCAACAAATATAAATC
TTAATAAAAAAGAAATAAAATTAAATTAAATTTAACAATTTGATTGCTTCATTAGTTATG
TTGATCAAATAAATACATCAAGAACAAATAAATTATAAATTTTTAATAAGTCTATAGATC
AAATTCAATTAAAAAGAAAATTTTCTTATTTTTTGTTTATAGTTTTGAAATTAAGGCAAA
TTCTATTATCTTTTATTTGTGATAACGACATTGTTTATATATTTTATGTATACTTCTATG
ATATTACAAATAATCATTTATGATAATTACTTT