Identifiers and Description

Gene Model Identifier

TTHERM_00370920

Standard Name

RPC34 (DNA-directed RNA polymerase III complex subunit Rpc34)

Aliases

PreTt28608 | 39.m00181 | 3693.m00028

Description

RNA polymerase Rpc34 subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF08279 ) HTH domain
  • ( PF05158 ) RNA polymerase Rpc34 subunit
  • ( PF01047 ) transcriptional regulator, MarR family
  • ( PF00325 ) transcriptional regulator, Crp/Fnr family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00370920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12247.14.0013667688777736e-172RNA polymerase Rpc34 subunit p
rotein (295 aa)
DictyBaseDDB_G02720221.0002869940498747e-21rpc34 on chromosome: 2 positio
n 1182004 to 1183004
WormBaseWBGene000211128.000721090200152e-18Probable DNA-directed RNA poly
merase III subunit RPC6 stat
us:Partially_confirmed UniPr
ot:P91529 protein_id:CCD6423
4.1
OxytrichaContig3819.0.g35.997612587164444e-16RNA polymerase Rpc34 subunit
SGDYNR003C0.0000000029989608248573072RPC34 RNA polymerase III subun
it C34; interacts with TFIIIB7
0 and is a key determinant in
pol III recruitment by the pre
initiation complex

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00370920(coding)
ATGGAAGAAGAATATTCAGAAAAGATAATTGGGATAGTGAAATCATACCAAGAGGGTATA
ACTTTAACTGAACTATTAAAGATATTAGAAGTTGATTAAAATGCCATTAAGCCAGAATTA
TAGAATTTATTAAAAGAAGGCTATTTAACTTGCACTAATGTAGGTAATGAATAAATAGTA
GAGTACCATGATCCTCAAGATTAGAAATAACTAAATGTGGCAGCAAGCGATCTACCTCAG
CAAGAATTTTAAGTTTATAAGATTATTTTCCAAGCTAAAAATAAAGGTATCGATAGAAAG
GATATAGGCAATAAAACTGGTATTGCAACGGGAACTTTAACTAAAATATTGAATTAACTT
AAGAAAAAAAATTGGATTAAATCAGTTAAAGGTGCAAATAGTACAGGAAAGGGTAAAAAT
ATATTTATTTTAAACAATCTAGAACTGTCTGAAAGTATTTCAGGTGGTATTTGGTATAAA
GATGGTGTCCTTAACAAAGATTTAATTGATGAGTTATGCTCAAAAATAGAAAACCATATG
AATCATAATCCTATAATGACTGAAGAATAAATTATTTAGTTATTAAGAGTTAATAGCTCA
ATCAATTTAGAATAAAGACATGTACTATAAATTATTAATTTATTACTTTTCGATGATAAA
ATTGAAAAAGTAAAAACAATTACAACATCAACCAATTCAAGTACAGCTTAAAAATAAGGA
ACCTCATAAATATAGAAGTATAGATTATCAAATTGGAATAAATCTAAAGACCACATTTCT
ACTATCCCAGCTTTGACAAAAACTCCGTGCGGACATTGTCCTTTAATTAACGAATGTGTT
CCTGGAGGGAAAATTTCACCAGAAAATTGTATTTATTTTAATGATTGGTGA


>TTHERM_00370920(protein)
MEEEYSEKIIGIVKSYQEGITLTELLKILEVDQNAIKPELQNLLKEGYLTCTNVGNEQIV
EYHDPQDQKQLNVAASDLPQQEFQVYKIIFQAKNKGIDRKDIGNKTGIATGTLTKILNQL
KKKNWIKSVKGANSTGKGKNIFILNNLELSESISGGIWYKDGVLNKDLIDELCSKIENHM
NHNPIMTEEQIIQLLRVNSSINLEQRHVLQIINLLLFDDKIEKVKTITTSTNSSTAQKQG
TSQIQKYRLSNWNKSKDHISTIPALTKTPCGHCPLINECVPGGKISPENCIYFNDW


>TTHERM_00370920(gene)
ATGGAAGAAGAATATTCAGAAAAGATAATTGGGATAGTGAAATCATACCAAGAGGGTATA
ACTTTAACTGAACTATTAAAGATATTAGAAGTTGATTAAAATGCCATTAAGCCAGAATTA
TAGAATTTATTAAAAGAAGGCTATTTAACTTGCACTAATGTAGGTAATGAATAAATAGTA
GAGTACCATGATCCTCAAGATTAGAAATAACTAAATGTGGCAGCAAGCGATCTACCTCAG
CAAGAATTTTAAGTTTATAAGGTAATAATAAAGTTTAAAAATGCAATAAAACTGATATTT
AATACTAAATTCTCTTTCAAATTTATGAAATAACAATAATTTTATTGACATTTCAAATAT
TTTTTGATAGACACATTAAAAAAACTGAAGCAAATAATTTAGGAAATTTGTGAATATGGT
ATATTGAATAAAAATAAATATCTAAGATTACCTTAAAAAGATAGTAAATGTATTAATAAT
ATAAAATTATACTTGATTTTCTACATAATAGATCTTATCCTATCATAGTTTATCTTTAAA
AAGATGATTTTTAGGCTAACTTCAAATTAATTATTATTTATAGCAAAAGAAATTGTTATT
TAATAAATTACTTAAATAATAAATTCTTGTTTGGATACACTGTTAAAACTTTATTTTTTA
AATTAAAATAAAATAGATTATTTTCCAAGCTAAAAATAAAGGTATCGATAGAAAGGATAT
AGGCAATAAAACTGGTATTGCAACGGGAACTTTAACTAAAATATTGAATTAACTTAAGAA
AAAAAATTGGATTAAATCAGTTAAAGGTGCAAATAGTACAGGAAAGGGTAAAAATATATT
TATTTTAAACAATCTAGAACTGTCTGAAAGTATTTCAGGTGGTATTTGGTATAAAGATGG
TGTCCTTAACAAAGATTTAATTGATGAGTTATGCTCAAAAATAGAAAACCATATGAATCA
TAATCCTATAATGACTGAAGAATAAATTATTTAGTTATTAAGAGTTAATAGCTCAATCAA
TTTAGAATAAAGACATGTACTATAAATTATTAATTTATTACTTTTCGATGATAAAATTGA
AAAAGTAAAAACAATTACAACATCAACCAATTCAAGTACAGCTTAAAAATAAGGAACCTC
ATAAATATAGAAGTATAGATTATCAAATTGGAATAAATCTAAAGACCACATTTCTACTAT
CCCAGCTTTGACAAAAACTCCGTGCGGACATTGTCCTTTAATTAACGAATGTGTTCCTGG
AGGGAAAATTTCACCAGAAAATTGTATTTATTTTAATGATTGGTGA