Identifiers and Description

Gene Model Identifier

TTHERM_00579280

Standard Name

RPC25 (DNA-dependent RNA polymerase III subunit Rpc25 )

Aliases

PreTt05821 | 78.m00193 | 3733.m00088

Description

DNA-dependent RNA polymerase III subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR00448 ) DNA-directed RNA polymerase
  • ( PF08292 ) RNA polymerase III subunit Rpc25
  • ( PF03876 ) RNA polymerase Rpb7, N-terminal domain
  • ( PF03293 ) poxvirus DNA-directed RNA polymerase, 18

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00579280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16339.11.9992982665753866e-121RNA polymerase Rpb7 domain-con
taining protein (217 aa)
SGDYKL144C0.00000000002000577768187062RPC25 RNA polymerase III subun
it C25, required for transcrip
tion initiation; forms a heter
odimer with Rpc17p; paralog of
Rpb7p
WormBaseWBGene000141110.00000000007999955850159168locus:rpc-25 status:Partiall
y_confirmed UniProt:Q23645
protein_id:CAA94858.1
DictyBaseDDB_G02734250.000000009996807949091551rpc25-1 on chromosome: 2 posit
ion 2980579 to 2981451
OxytrichaContig21831.0.g920.000000009996807949091551SHS2 domain found in N terminu
s of Rpb7p/Rpc25p/MJ0397

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00579280(coding)
ATGTTTATTTTATGCACTAAAAGAGAAAAGATCAGACTTAAACCTGACAGTCTTGGAAAG
GATTACCAAAAAAACATTACAAAATTATTATATGAAACATATTTATTCAAGGCAATTAAT
GAAAATGAGGTTATTGTAGCTATTAAAGATGTTACTCTGTATGATGGATTTGTAGAATAA
GTAACAGGAGAAGTCGTTTTCGAAATCTAAATGACTTATCTCGTCCAGTAAATAGTTTAA
AATGAAGTCTATGAAGGAACAATCGTTTCATAAAATGCTAAAGGAATTACTGTTAAATTT
GGATAGCTCTAGGCTTTTATTGGTAAACATCTACTTCAGCCAAACTCTACATTTTTCAAG
GATAAAAACGAATGGATTTGGTAGAATGATGAAGAAGACAGCTCTAGCGTGCTCTTCTAT
GAAGCAGATGCTTAGGTTAAATTCAAAATATTTGCCATTAATTTCTTGGCGAAGATTGAC
GAAGTTAACCCAGAAGGATAAAAGCAAATCATAGGTGCGATGAATGAAGATGGCCTTGGT
TTGATATAATGGTGGGATTTCTGA


>TTHERM_00579280(protein)
MFILCTKREKIRLKPDSLGKDYQKNITKLLYETYLFKAINENEVIVAIKDVTLYDGFVEQ
VTGEVVFEIQMTYLVQQIVQNEVYEGTIVSQNAKGITVKFGQLQAFIGKHLLQPNSTFFK
DKNEWIWQNDEEDSSSVLFYEADAQVKFKIFAINFLAKIDEVNPEGQKQIIGAMNEDGLG
LIQWWDF


>TTHERM_00579280(gene)
TTTTAACTTATTTAACATCAGCAAAGAAACAAACAAAAATTTGTACCAAGATTTAAAGAC
CACAATAAATTTATTATTCTAACCCTTTTCCAAATTAAATCAGAAAGAAACATGTTTATT
TTATGCACTAAAAGAGAAAAGATCAGACTTAAACCTGACAGTCTTGGAAAGGATTACCAA
AAAAACATTACAAAATTATTATATGAAACATATTTATTCAAGGTGCGAACTATTTACTAA
ATTAACCAATCAATCATTAATTGCTTGAATTTAATGAATTTTTTATTTACTAATACACTT
CATATTTATTAATACAAAATATTATTCAAAAGGCAATTAATGAAAATGAGGTTATTGTAG
CTATTAAAGATGTTACTCTGTATGATGGATTTGTAGAATAAGTAACAGGAGAAGTCGTTT
TCGAAGTAAGTTGCGCAATTAAATTTATAGATTATAATAAATTTATTATTGTTCAAAACT
AGATCTAAATGACTTATCTCGTCCAGTAAATAGTTTAAAATGAAGTCTATGAAGGAACAA
TCGTTTCATAAAATGCTAAAGGAATTACTGGTAAAATTAAAATTATTCTTTTTTTGAAAA
AATAAAAAAAACCTTAATCTACTTAATGTTTTTAATTCTCAATCAATAATTAAATATTTC
TCATTTAAATTTAATTAATTAAGTTAAATTTGGATAGCTCTAGGCTTTTATTGGTAAACA
TCTACTTCAGCCAAACTCTACATTGTATCTTTTTTCTTATATTTAATATATATATTTACA
TTTATTTATTAATCATTACGAAATATCTTTTAATTTTTTAATTCATTTGATTAACTCTTC
TAATAACAGCAAACTTATTTTAAAATACTTGTTTAGATAATTCAAAACGTATTTTTAATA
GTTTTTATTTAAATTTCATACATAAAATAGTTTCAAGGATAAAAACGAATGGATTTGGTA
GAATGATGAAGAAGACAGCTCTAGCGTGCTCTTCTATGAAGCAGATGCTTAGGTTAAATT
CAAAATATTTGCCATTAATTTCTGTAATTTTAATTAATTTAAACAATTTTCGTTTTGTAT
TAATAATTTTCTTTAAACAACAAAAGTGGCGAAGATTGACGAAGTTAACCCAGAAGGATA
AAAGCAAATCATAGTATTTTATTATTTTGAACATAAATTGCTTAATAAAGTTCATGTGTA
AATTTTATCTCTAAAATTCATAAAAAATAGGGTGCGATGAATGAAGATGGCCTTGGTTTG
ATATAATGGTGGGATTTCTGA