Identifiers and Description

Gene Model Identifier

TTHERM_00085650

Standard Name

RPC2 (DNA-directed RNA polymerase III subunit RPC2)

Aliases

PreTt16413 | 6.m00487 | 3836.m02081

Description

Second largest subunit of RNA polymerase III

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF04560 ) RNA polymerase Rpb2, domain 7
  • ( PF04561 ) RNA polymerase Rpb2, domain 2
  • ( PF04565 ) RNA polymerase Rpb2, domain 3
  • ( PF04566 ) RNA polymerase Rpb2, domain 4
  • ( PF04567 ) RNA polymerase Rpb2, domain 5
  • ( PF00562 ) DNA-directed RNA polymerase, beta subunit
  • ( PF04563 ) DNA-directed RNA polymerase, beta subunit
  • ( TIGR02013 ) DNA-directed RNA polymerase, beta subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00085650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_210470
WormBaseWBGene000173009.997093137033517e-262locus:rpc-2 DNA-directed RNA
polymerase status:Confirmed
UniProt:Q27492 protein_id
:CCD68383.1
Tetrahymena borealisEI9_02458.19.997093137033517e-262DNA-directed RNA polymerase, b
eta subunit protein (1138 aa)
DictyBaseDDB_G02884499.997093137033517e-262rpc2 on chromosome: 5 position
1494028 to 1499084
OxytrichaContig6272.0.g559.997093137033517e-262RNA polymerase Rpb2, domain 6
SGDYOR207C9.997093137033517e-262RET1 Second-largest subunit of
RNA polymerase III, which is
responsible for the transcript
ion of tRNA and 5S RNA genes,
and other low molecular weight
RNAs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00085650(coding)
ATGGCTTCAAAAACTGCTGAACCATTACGCGAAAAAACAAGAATTATTGATTCTTATTTA
GCACATAATGGATTTGTTAGTCATCACATATAATCATTTAATTACTTTATCAATATAAAA
TTGCAATAAATTATTACATCATCAATGAATAAGGAATTGCGTTTAGATACAGACAACTCT
TTCTTACTAGAATATACCAAAATTTATATTGAGCCTCCTGCTCATGACAATAAAACAATG
ATGCTTCCTTAAGAAGCTAGATTGAGTAACTCTTCTTATGCAGGGAATATTTATGTTGAT
TGTGAACTCACATTTAATGGAAAGAAAGAAGATAGTTTGAGAAAGGTCAATATTGGAAAA
ATGCCAATTATGCTTGGATCTAGTCACTGCAATTTAATCAAAGCTTTGGAGTTAGGATAA
GTCCATAAATTATAAGAATGTGCTAATGACCCAAGAGGGTATTTCATTATCAAGGGAGTA
GAAAAGGTTTTCCTCATTTAAGAATAATTAGCTGATAATAGAATTTTCATTGAAGAAGAC
AAAAACAAAGAGTTAGTTGCTAACGTTAAATCAAACACAGTTGATACTAAATCAATCACT
TCATTAATTATCAAAAATCATAAAATTTATGTCAAAGTCAGTTCATTCAGCAAGCCTATT
CCTTTGCTTATATTTTTTAAGGCATACGGAGTAGAATCAGAATAGGAAATATTCTAGTTA
ATAGGTACTGAAGAGCACTTGCTCAATCGTCTAGCTCTATGCTTAGAAGATATTGAATAA
TCTCAAGTTTACACATAACAATAAGCCTTAGAATATCTCTCTAAGCGTCTAAGACCTAAA
ACGTTCTAAGATAAAAAATATTCCTCAAGAAATCCAGTTGACGAAGCAAGAGATATAATA
ACAAATGTCGTTTTGTGTCACATTCCTTGCAAGAATTATAACTATTATCCTCGTGCTATT
TTCTTGGGTTTGATGGCAAGAAGATTAATTGAAGCCTTGGATGACCCAAGCAAAATTGAT
AAGAGAGATTACTATGGTAACAAGAGAATGAAATGTGCTGGTTGGTACTTGGAATTACTT
TTTGAAGATAAATTTAAATAATTTAACATGATGGTTAGAAAAGAGCTCAGCAAAGAAATA
GAAAAGCACAAAAATAAATCTTACCCAATTAAAAACAGAGTAGAATCTATTTTAGAGAAG
AACCATGATATTATTACTTAAGGTTTGAATAATGCTATTTCAACTGGTAATTGGACAATT
AAGCGTTTTAGAATGGACACTGTTGGTGTTACCCAAGTCTTAGCAAGAATCTCATATATA
GCTGCTATTGGTATGATGACTAGAATGAACAGTCAATTTAAAAAATCAAGAAAGTTAACT
GGTCCTAGATCTTTGCTTGGTTCTCATTGGGGTTTAGTTTGTCCTGCTGATACTCCAGAT
GGTGAATCTTGTGGTTTAACAAAGAATCTTTCTCTGATGGCTCATATTACTATTGAAGAA
AAGAAAAATGTACTTTCAACTATTGCTTTGAATTTAGGTATGGAAGACATTGGACATTAC
AGCTCAGGAGAAATCCATGAAGATAAAAATTATATGGTTTTCTTAAATGGTTAAATTATT
GGTATGCACAGAGATCCTGAGGCTTTTGCTTAAAAATTAAGATTTATGAGAAGAAGAGGT
AAAATTGGTACTACTATTAGTATAAGCACAAACTCTGAAAAGAGAGCAGTTTATTTAGAT
ACAGATGATGGTAGACTTTGCAGATTATTAATTGTAGTAGAGAATGGAAAACCTTTGATC
ACTAATGACCATTTAAACGACTTAAAGGAAAAAAGAAAGAGCTATTTGGATTTAATTAGA
ATGGGTTTAATCGAATATATTGATGTTAATGAAGAAGATAATTGTTATATTGCTATTAAA
TAGGAAGATATTCCAAATCGTAGCAAGACTACTCATATGGAAATAGATCCATTAACATTA
TTAGGTGTAGTTTCAGGATTAGTTCCTTACCCACATCATAACCAAGCAAGTAGAAATACT
TTCTAATGTGCTATGGGTAAGCAGGCACTTGGTATTATTGGTAGTACTTCTATGAATAGA
GTTGATACAATTCTTTACTAACTAATTTATCCTTAAACTCCTTTGCTTAAAACCAAAGTT
ATTGAATATGCTGGTTACGATAAATTCCCAGCTGGTCACAATGCAAGTATTGCAGTTCTA
AGTTATTCTGGTTATGATATAGAAGATGCTACTGTACTAAATAAATCATCTCTTGATAGA
GGATTTGGTAGAACAATGGTTTTTAAGAAGTATGAAACTGAAATTCAAAAGCTCAAAATG
TCTGGTTTAACTGAATTACTAAGAGGTCCTCCAAAAGAAGCAGAAGGCTCATATAAAAAG
AAATAAAACAGAGTTTTAAAGAAGTTTGGTGCTTTGGATGATGATGGTACTCCTATAGTA
GGTGCCTCTATTAACAATGGCGATGTCTTATTCAACAAGTATACTCCTTTACTTACTCTC
GAATAGTAAAGAGGTCGTGATATTCTCAACAATAACTCTGTCTCTGAATATATTCATAAT
CCTACTACATTCAAAGGTAAAAAATTAGCTAGAATCGATAGAGTTATTAGAAGTCAATAA
GATGGAAACGTTATCATTAAAACTATAGTTAGAGAAACCCGTAGACCAGAATATGGTGAT
AAATTTAGTTCAAGACATGGTCAAAAAGGTATTATTGGTTTAATAGTAAATTAAGAAGAT
ATGCCATTCAGCGAGAAAGGTTGGGTCCCAGATTTAATTATGAATCCTCACGGTTACCCT
TCTCGTATGACAGTTGGCAAGCTCTTAGAATTGCTTGGTTCAAAGGCAGCTGTTTTATCT
GGATAGTTTAAGTACGGCACAGCATTTGGAGGAGATAAGATGGCTGATTTATCTTCAATT
TTAGTATAGAATGGATTTTCATATACAGGTAAAGATGTTATCATAAGTGGTATCACTGGT
GAATATATGTAGTGCTATGTTTTCTGCGGTCCTGTATTCTATTAGAGATTAAAACACATG
GTTGCTGATAAAGTTCATGCTCGTGCAAAAGGAAGAGTAACAACTCTTACAAGATAACCT
ACTGAAGGTAGAGCAAAAGATGGTGGTTTAAGATTAGGAGAAATGGAAAGAGATAGTTTA
TTAGCTTTTGCTTCATCAAACTTGCTGATAGAAAGATTGATGATAAGTTCTGATAAATTT
TCTGTATAAGTTTGTGAGAAATGTGGTTTCATTCAGCATACAAATAGTTGCAAGATGTGC
TAAACTGATTAGGTTAGCAAGGTAGTCATGCCTTATGCTTGCAAACTGCTTTTCTAAGAG
CTTCTTTCAATGAATATAAAACCAAAATTGAATCTTGTTGATATAAATAAAATTGAAAAC
TCTTGA


>TTHERM_00085650(protein)
MASKTAEPLREKTRIIDSYLAHNGFVSHHIQSFNYFINIKLQQIITSSMNKELRLDTDNS
FLLEYTKIYIEPPAHDNKTMMLPQEARLSNSSYAGNIYVDCELTFNGKKEDSLRKVNIGK
MPIMLGSSHCNLIKALELGQVHKLQECANDPRGYFIIKGVEKVFLIQEQLADNRIFIEED
KNKELVANVKSNTVDTKSITSLIIKNHKIYVKVSSFSKPIPLLIFFKAYGVESEQEIFQL
IGTEEHLLNRLALCLEDIEQSQVYTQQQALEYLSKRLRPKTFQDKKYSSRNPVDEARDII
TNVVLCHIPCKNYNYYPRAIFLGLMARRLIEALDDPSKIDKRDYYGNKRMKCAGWYLELL
FEDKFKQFNMMVRKELSKEIEKHKNKSYPIKNRVESILEKNHDIITQGLNNAISTGNWTI
KRFRMDTVGVTQVLARISYIAAIGMMTRMNSQFKKSRKLTGPRSLLGSHWGLVCPADTPD
GESCGLTKNLSLMAHITIEEKKNVLSTIALNLGMEDIGHYSSGEIHEDKNYMVFLNGQII
GMHRDPEAFAQKLRFMRRRGKIGTTISISTNSEKRAVYLDTDDGRLCRLLIVVENGKPLI
TNDHLNDLKEKRKSYLDLIRMGLIEYIDVNEEDNCYIAIKQEDIPNRSKTTHMEIDPLTL
LGVVSGLVPYPHHNQASRNTFQCAMGKQALGIIGSTSMNRVDTILYQLIYPQTPLLKTKV
IEYAGYDKFPAGHNASIAVLSYSGYDIEDATVLNKSSLDRGFGRTMVFKKYETEIQKLKM
SGLTELLRGPPKEAEGSYKKKQNRVLKKFGALDDDGTPIVGASINNGDVLFNKYTPLLTL
EQQRGRDILNNNSVSEYIHNPTTFKGKKLARIDRVIRSQQDGNVIIKTIVRETRRPEYGD
KFSSRHGQKGIIGLIVNQEDMPFSEKGWVPDLIMNPHGYPSRMTVGKLLELLGSKAAVLS
GQFKYGTAFGGDKMADLSSILVQNGFSYTGKDVIISGITGEYMQCYVFCGPVFYQRLKHM
VADKVHARAKGRVTTLTRQPTEGRAKDGGLRLGEMERDSLLAFASSNLLIERLMISSDKF
SVQVCEKCGFIQHTNSCKMCQTDQVSKVVMPYACKLLFQELLSMNIKPKLNLVDINKIEN
S


>TTHERM_00085650(gene)
ATGGCTTCAAAAACTGCTGAACCATTACGCGTAAATTTAACTATTTAGCTTTAGCAAACA
AATTTATAGCCTTTTGAATAAATAAAACCCCCTTTTTACATTGAATAGCCATAGGAGAAG
ATTTATAATATTCATTAGATCTAATTTTAAAAACAAACTAAATAGAGTGGTTCAGAATGG
CATGATAAAATTATTTTATACAATTATTATTGATAAACTGAAATATTTGTAATTAATATG
TTTATTTTAAATTATTATTTAGGAAAAAACAAGAATTATTGATTCTTATTTAGCACATAA
TGGATTTGTTAGTCATCACATATAATCATTTAATTACTTTATCAATATAAAATTGCAATA
AATTATTACATCATCAATGAATAAGGAATTGCGTTTAGATACAGACAACTCTTTCTTACT
AGAGTGATCTTTAATTAATACAATATTTTATACTTACAATTAATTATTTTATTAGATATA
CCAAAATTTATATTGAGCCTCCTGCTCATGACAATAAAACAATGATGCTTCCTTAAGAAG
CTAGATTGAGTAACTCTTCTTATGCAGGGAATATTTAGTAAATTTTTATATTACACTGAA
TGAAAGTATATAAATTTATAATATATTAGTGTTGATTGTGAACTCACATTTAATGGAAAG
AAAGAAGATAGTTTGAGAAAGGTCAATATTGGAAAGTAATTAAACAAATAAAAATATATC
TAAGTTTATTTATTTTAAATTTAACAGTCTAATTAATTAATAATCTATTTTGTATAATAT
TTCTATTTTTATTAAAAGAATGCCAATTATGCTTGGATCTAGTCACTGCAATTTAATCAA
AGCTTTGGAGTTAGGATAAGTCCATAAATTATAAGAATGTGCTAATGACCCAAGAGGGTA
TTTCATTATCAAGGGAGTAGAAAAGGTAATTTTTGCTTAAATTGATATATGTTATTGAGT
TTAAATCTCATTAGATTTATTTTTATCGAATAAAAATACAATTTTTTATAATATTTAATA
ATAGGTTTTCCTCATTTAAGAATAATTAGCTGATAATAGAATTTTCATTGAAGAAGACAA
AAACAAAGAGTTAGTTGCTAACGTTAAATCAAACACAGTTGATACTAAATCAATCACTTC
ATTAATTATCAAAAATCATAAAATTTATGTCAAAGTCAGTTCATTCAGCAAGCCTATTCC
TTTGCTTATATTTTTTAAGGCATACGGAGTAGAATCAGAATAGGAAATATTCTAGTTAAT
AGGTACTGAAGAGCACTTGCTCAATCGTCTAGCTCTATGCTTAGAAGATATTGAATAATC
TCAAGTTTACACATAACAATAAGCCTTAGAATATCTCTCTAAGCGTCTAAGACCTAAAAC
GTTCTAAGATAAAAAATATTCCTCAAGAAATCCAGTTGACGAAGCAAGAGATATAATAAC
AAGTAAGCTATTTTTTTACAAATTTTACCAGCAAACTTATTAGTTTAAAACGGAATAATT
TGAGCTATTATTGATATGGTTTGTTAAATAAAATTTAATGATCAATCATTCAACATAATT
TATTAAAAATTAGATGTCGTTTTGTGTCACATTCCTTGCAAGAATTATAACTATTATCCT
CGTGCTATTTTCTTGGGTTTGATGGCAAGAAGATTAATTGAAGCCTTGGATGACCCAAGC
AAAATTGATAAGAGAGATTACTATGGTAACAAGAGAATGAAATGTGCTGGTTGGTACTTG
GAATTACTTTTTGAAGATAAATTTAAATAATTTAACATGATGGTTAGAAAAGAGCTCAGC
AAAGAAATAGAAAAGCACAAAAATAAATCTTACCCAATTAAAAACAGAGTAGAATCTATT
TTAGAGAAGAACCATGATATTATTACTTAAGGTTTGAATAATGCTATTTCAACTGGTAAT
TGGACAATTAAGCGTTTTAGAATGGACACTGTTGGTGTTACCCAAGTAAATTACTTTAAA
ATATTTTTTATATTTTATTAACTATCTTCTCTTCAAAGGTCTTAGCAAGAATCTCATATA
TAGCTGCTATTGGTATGATGACTAGAATGAACAGTCAATTTAAAAAATCAAGAAAGTTAA
CTGGTCCTAGATCTTTGCTTGGTTCTCATTGGGGTTTAGTTTGTCCTGCTGATACTCCAG
ATGGTGAATCTTGTGGTTTAACAAAGAATCTTTCTCTGATGGCTCATATTACTATTGAAG
AAAAGAAAAATGTACTTTCAACTATTGCTTTGAATTTAGGTATGGAAGACATTGGACATT
ACAGCTCAGGAGAAATCCATGAAGATAAAAATTATATGGTTTTCTTAAATGGTTAAATTA
TTGGTATGCACAGAGATCCTGAGGCTTTTGCTTAAAAATTAAGGTACTAAATTAATTTAT
TTTTATGAAAATGAATATTGAAAAGCTAAATTAATTTATTATCAGATTTATGAGAAGAAG
AGGTAAAATTGGTACTACTATTAGTATAAGCACAAACTCTGAAAAGAGAGCAGTTTATTT
AGATACAGATGATGGTAGACTTTGCAGATTATTAATTGTAGTAGAGAATGGAAAACCTTT
GATCACTAATGACCATTTAAACGACTTAAAGGAAAAAAGAAAGAGCTATTTGGATTTAAT
TAGAATGGGTTTAATCGAATATATTGATGTTAATGAAGAAGATAATTGTTATATTGCTAT
TAAATAGGAAGATATTCCAAATCGTAGCAAGACTACTCATATGGAAATAGATCCATTAAC
ATTATTAGGTGTAGTTTCAGGATTAGTTCCTTACCCACATCATAACCAAGCAAGTAGAAA
TACTTTCTAATGTGCTATGGGTAAGCAGGCACTTGGTATTATTGGTAGTACTTCTATGAA
TAGAGTTGATACAATTCTTTACTAACTAATTTATCCTTAAACTCCTTTGCTTAAAACCAA
AGTTATTGAATATGCTGGTTACGATAAATTCCCAGCTGGTCACAATGCAAGTATTGCAGT
TCTAAGTTATTCTGGTTATGATATAGAAGATGCTACTGTACTAAATAAATCATCTCTTGA
TAGAGGATTTGGTAGAACAATGGTTTTTAAGAAGTATGAAACTGAAATTCAAAAGCTCAA
AATGTCTGGTTTAACTGAATTACTAAGAGGTCCTCCAAAAGAAGCAGAAGGCTCATATAA
AAAGAAATAAAACAGAGTAAAATCAAAAATTTATTTGTTTTTTTTTTTCTAAATTTAGCA
TTTGTAAATAGGTTTTAAAGAAGTTTGGTGCTTTGGATGATGATGGTACTCCTATAGTAG
GTGCCTCTATTAACAATGGCGATGTCTTATTCAACAAGTATACTCCTTTACTTACTCTCG
AATAGTAAAGAGGTCGTGATATTCTCAACAATAACTCTGTCTCTGAATATATTCATGTAA
GAAATATCTCATTTTTCACTTAATTTTTTATTAAAATAAATATAAATAAAAAAAAAGAAT
CCTACTACATTCAAAGGTAAAAAATTAGCTAGAATCGATAGAGTTATTAGAAGTCAATAA
GATGGAAACGTTATCATTAAAACTATAGTTAGAGAAACCCGTAGACCAGAATATGGTGAT
AAATTTAGTTCAAGACATGGTAAGAATTTATTTTTATTTAAAAAATAAAGAAAAGTCAAT
CAATTTTTAATTAAAATTAATTTAGGTCAAAAAGGTATTATTGGTTTAATAGTAAATTAA
GAAGATATGCCATTCAGCGAGAAAGGTTGGGTCCCAGATTTAATTATGAATCCTCACGGT
TACCCTTCTCGTATGACAGTTGGCAAGCTCTTAGAATTGCTTGGTTCAAAGGCAGCTGTT
TTATCTGGATAGTTTAAGTACGGCACAGCATTTGGAGGAGATAAGATGGCTGATTTATCT
TCAATTTTAGTATAGAATGGATTTTCATATACAGGTAAAGATGTTATCATAAGTGGTATC
ACTGGTGAATATATGTAGTGCTATGTTTTCTGCGGTCCTGTATTCTATTAGAGATTAAAA
CACATGGTTGCTGATAAAGTTCATGCTCGTGCAAAAGGAAGAGTAACAACTCTTACAAGA
TAACCTACTGAAGGTAAATTATTTATTAAATAAATAAAATAATTTAATTTTTTTTAATTA
GAATGCCTTAAAAATACTTTTTTGATATTAAATTTTTTAATTTGCTAAATATATAATAGG
TAGAGCAAAAGATGGTGGTTTAAGATTAGGAGAAATGGAAAGAGATAGTTTATTAGCTTT
TGCTTCATCAAACTTGCTGATAGAAAGATTGATGATAAGTTCTGATAAATTTTCTGTATA
AGTTTGTGAGAAATGTGGTTTCATTCAGCATACAAATAGTTGCAAGATGTGCTAAACTGA
TTAGGTAAATTAAAAAAAAATTATTTATTGATTTTAATATTTGAATAGTTTTGTAACATA
AAAAATCTAATTGATATTATTTAAAAAAACAAAATATTAACTTTGAGCTATTCATAAAAT
ATTATTTTTGAATTATAAATTTTATCATAAAAATAAAACATATTTTATTAATTCTAAGTA
ACTAATTAATACTTTTGTTAAATAATAGGTTAGCAAGGTAGTCATGCCTTATGCTTGCAA
ACTGCTTTTCTAAGAGCTTCTTTCAATGAATATAAAACCAAAATTGAATCTTGTTGATAT
AAATAAAATTGAAAACTCTTGA