Identifiers and Description

Gene Model Identifier

TTHERM_00011760

Standard Name

RPC19 (RNA polymerases I and III common subunit Rpc19 )

Aliases

PreTt11782 | 1.m00830

Description

RNA polymerases I and III common subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01563 ) phage head-tail adaptor, putative
  • ( PF01193 ) RNA polymerase Rpb3/Rpb11 dimerisation domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00011760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02771.16.001309080488961e-82DNA-directed RNA polymerase I
subunit D (150 aa)
SGDYNL113W1.9993007828132465e-27RPC19 RNA polymerase subunit A
C19, common to RNA polymerases
I and III
OxytrichaContig22515.0.g143.99801309251602e-27RNA polymerase Rpb3/Rpb11 dime
risation domain
DictyBaseDDB_G02913623.999970367130025e-21rpc19 on chromosome: 6 positio
n 182518 to 183059
WormBaseWBGene000102307.000255027549774e-17locus:rpac-19 Probable DNA-d
irected RNA polymerases I and
III subunit RPAC2 status:Con
firmed UniProt:P34476 prot
ein_id:CAA80165.1
Stentor CoeruleusSteCoe_216540.00000000027894680928689246

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00011760(coding)
ATGTCAGATAGCGAAGAAAATTCATTCCAAGAAATTGAATAGGAAGATGACGAAGCTGTC
AACAATCCTGATATTGAAGAGGAAGAAGAAGATGAAGATTATATGATGGAAGATAAGCCT
AAAAAGCAATCTGCAGAAGAAAAGCTTGTTATTGACTAAAATGAAAAAGATAGAACTTGC
GCTACTTATACTTTCTATGATGAAGACCACACCCTTGGAAATACAGTTAGATATATGCTT
GTAAAGAGAAAAGATGTAGAATTCTGTGGTTATACAATTCCTCACCCTTCTGAAAATAAA
ATGAATTTACGTTTATAAACAATAAAAAAAAATTCAAATGAAGTATTAAAAGAAGGATTA
GATAGTTTGGCTGGACTTTGTGATGTACTTAATGACAAATTTGATGCTGCTATGAAAAAA
TTTGAAAAACAATAAAAAAAGAAATCAAAATGA


>TTHERM_00011760(protein)
MSDSEENSFQEIEQEDDEAVNNPDIEEEEEDEDYMMEDKPKKQSAEEKLVIDQNEKDRTC
ATYTFYDEDHTLGNTVRYMLVKRKDVEFCGYTIPHPSENKMNLRLQTIKKNSNEVLKEGL
DSLAGLCDVLNDKFDAAMKKFEKQQKKKSK


>TTHERM_00011760(gene)
ATGTCAGATAGCGAAGAAAATTCATTCCAAGAAATTGAATAGGAAGATGACGAAGCTGTC
AACAATCCTGATATTGAAGAGGAAGAAGAAGATGAAGATTATATGATGGAAGATAAGCCT
AAAAAGCAATCTGCAGAAGAAAAGCTTGTTATTGACTAAGTAATAAATTATCAAAGATTA
ATTGATTGATTAAATTAGGAATAGAAATGAAAACATAAAAAATTGAGTTAGTTTTTAAGA
CTAAAGCATAGAATTTACGATAATTACAAAATAAATGTTTTTAATAAGCAAGCTGAACAT
TTTTTTATAAAATTAGAATGAAAAAGATAGAACTTGCGCTACTTATACTTTCTATGATGA
AGACCACACCCTTGGAAATACAGTTAGATATATGCTTGTAAAGAGAAAAGATGTAGAATT
CTGTGGTTATACAATTCCTCACCCTTCTGAAAATAAAATGAATTTACGTTTATAAACAAT
AAGTAATTTGGTTTATTAGTTTGTGCTTAGTTTTATAAAATAATACATTTTTTTCATAAA
ATAATAGAAAAAAATTCAAATGAAGTATTAAAAGAAGGATTAGATAGTTTGGCTGGACTT
TGTGATGTACTTAATGACAAATTTGATGCTGCTATGAAAAAATTTGAAAAACAATAAAAA
AAGAAATCAAAATGA