Identifiers and Description

Gene Model Identifier

TTHERM_00444250

Standard Name

RPC11 (RNA polymerase III complex subunit Rpc11 )

Aliases

PreTt03793 | 51.m00159 | 3704.m00014

Description

RNA polymerase III complex subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08274 ) PhnA Zinc-Ribbon
  • ( TIGR01384 ) transcription factor S
  • ( PF02150 ) RNA polymerases M/15 Kd subunit
  • ( PF01096 ) transcription factor S-II (TFIIS)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 25.1%

TetraMine Data

TTHERM_00444250

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10934.11.000296925633081e-74hypothetical protein (109 aa)
OxytrichaContig10554.0.g230.0000000000005000841553255702Transcription factor S-II (TFI
IS)
WormBaseWBGene000223090.000000000003001226732525078locus:rpc-11 DNA-directed RN
A polymerase subunit status:
Partially_confirmed UniProt:
Q9N4B7 protein_id:CCD72590.1
SGDYDR045C0.00000000030007160092483236RPC11 RNA polymerase III subun
it C11; mediates pol III RNA c
leavage activity and is import
ant for termination of transcr
iption; homologous to TFIIS
DictyBaseDDB_G02877070.000000004999139696582238rpc11 on chromosome: 5 positio
n 584047 to 584459

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00444250(coding)
ATGAATTTCTGTCCTTTATGCGCTAATGCTCTTATTATTCAGAATGTTGGAGGAAATAAT
AGATTTTCTTGTAGAACATGTACATATTTTTATCCACTACTAAAGAAAATAGAAACAGTA
ACATACTCTAGAATGGTTAAAGATGATACTATTCATGATATTTCTCTATAAAAAGAATCT
CTATAAACTGATAAAGATATGATTTGCCCTGCTTGTGAGAAGAGAGGTGCCTATATAAGA
CTGGAATAAGATAGAAGTCTTGATGAAGGCTAAACATAACATTATATTTGTAAAAATTGC
TCACATACTTGGAAAGATATGGGGTGA


>TTHERM_00444250(protein)
MNFCPLCANALIIQNVGGNNRFSCRTCTYFYPLLKKIETVTYSRMVKDDTIHDISLQKES
LQTDKDMICPACEKRGAYIRLEQDRSLDEGQTQHYICKNCSHTWKDMG


>TTHERM_00444250(gene)
ATGAATTTCTGTCCTTTATGCGCTAATGCTCTTATTATTCAGAATGTTGGAGGAAATAAT
AGATTTTCTTGTAGAACATGTACATATTTTTATCCACTACTAAAGAAAATAGAAACAGTA
ACATACTCTAGAATGGTTAAAGATGATACTATTCATGATATTTCTCTATAAAAAGAATCT
CTATAAACTGATAAAGATAGTAATTATCAATAAATTATTTTTTTTCTTTTTAAAAATAAA
ATTATCAAGCTGATTCTTTTAAAATGTTATTAATGCAATATTTTAATAAATAAAAAAAAG
TGATTTGCCCTGCTTGTGAGAAGAGAGGTGCCTATATAAGACTGGAATAAGATAGAAGTC
TTGATGAAGGCTAAACATAACATTATATTTGTAAAAATTGCTCACATACTTGGAAAGATA
TGGGGTGA