Identifiers and Description

Gene Model Identifier

TTHERM_00037340

Standard Name

RPC1 (RNA polymerase III largest subunit Rpc1)

Aliases

PreTt14469 | 2.m02145 | 3825.m02839

Description

RNA polymerase III largest subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00037340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_377350
WormBaseWBGene000044119.997093137033517e-262locus:rpc-1 DNA-directed RNA
polymerase status:Partially
_confirmed UniProt:Q18566
protein_id:CCD66619.1
Tetrahymena borealisEI9_00989.19.997093137033517e-262RNA polymerase Rpb1, domain 2
family protein (1437 aa)
DictyBaseDDB_G02771999.997093137033517e-262rpc1 on chromosome: 2 position
7733653 to 7738100
OxytrichaContig21914.0.g479.997093137033517e-262RNA polymerase Rpb1, domain 5
SGDYOR116C9.997093137033517e-262RPO31 RNA polymerase III large
st subunit C160, part of core
enzyme; similar to bacterial b
eta-prime subunit and to RPA19
0 and RPO21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00037340(coding)
ATGTAAATGAGCGTTATTTAGCCTTTGAGGTAGTTAAAGGAGACTAAAAGAATTGGTAGC
ATCCAATACAGTATCTTATCTACTAATGAAATTATAGATATGTCTGAAGTGTGCCTTGAT
GAGCCTTCTTTTTATAATTAAACTACTCGTGCACCTTTAAATCGTGGTCCCTTAGATTTA
AGAATGGGTCCTTCAATGCGTGAAAATAATTTGAAATGTCAAACATGTAATTAAGAAATG
TTGGAATGTCCAGGTCATTTTGGTTTTATTAAATTGGCTCTACCAATATTCCATATAGGT
TTTTTTGGTGATGTCATTAACATCCTTTAATGTATTTGCAAGAGTTGTGGTAAGGTTTTG
CTGGATGAAGATGAAAAGAAGAACTCAATGAAAAGAATGCAAAAAGCTATTGATGACAAA
AATTATCAATTAAGAGCTGATTTGTATGTAAAAATGAGAAAAGAATGCAAAAAAGGTGCC
AACTAAAAATGTAGGTCTTGTGGATATAAAAACGGACCCTTAAAGAAAATGCCTAAAATG
CCTACAACTATTAGTTTTTCTGATCAAACCAAATTAGAATAGGATTTTCGTGACATTAGA
GAATCTGAAGACATATTTTAAGAGAATTTAAGAAAAATTTTGGAAAGTAAAAATATGAAG
GAAATGATTGAAATATTAAATCCTTTAGAAACCTATAAAATTTTCAGAAAAATTACATGT
GATGAAATTTTATTATTTAATATTCAATAAAACCATCCTTGTGATTTAATTCTCACTCAT
ATCATAGCACCCCCAGCTTGTATAAGACCAACTGTTAAAGAAGGAGAATCTAATGTTCGT
CACGATGATCTCACTGTTAAAATTAGAGATTTTTTGGACAGAAATAAAAGAATTGCTTAG
ATGATAGAAGATGGTGAAGATTTAATTAAAATTAACTAAGAGTGGTTCTTACTTTAGTGT
TCACATGCTCACTATTTGAATGCTGAAACTCCAAACTTGCCTTTTAAAATGGACAAAGAT
TTTGGTAAAAAGGATATTAGAGCACTTGCACAAAGATTAAAAGGTAAAAAAGGTAGATTC
AGAGGTAATCTTTCTGGTAAAAGATCAAACTTTACAGGTAGAACTGTTATTTCTCCTGAC
CCTAACATCCCTATTGATAATGTTGTTGTTCCTGAATACATGGCTAAAATTCTCACTTTC
CCTGAATAAGTTAATGCTATCAATATCGAAAGATTAAAAAAATTAGTTATAAATGGACCT
GAAAAATATCCAGGAGCTCATTATATAATAGCAAAAGACACAGAAGACAAATTTAATCTA
TCAATAGATAATAGAAGAAAGAAAGCAGATGAACTCAAGATTGGTGATATTGTAGAAAGA
CACATCCAAAACGGAGAAATTTTACTTTTTAATAGACAGCCTTCTTTGCATAGAATTTCA
ATTATGGCATTCAAGGCCAATATATAAAAATGGAATACAATCAGATTTAATGAATGTTGC
TGTGCTCCTTTCAATGCTGATTTTGATGGTGATGAAATGAATATTCATGTTCCATAAACA
ATAGAAGCAAGAGCTGAGGCCTAATATCTCCTTGATGTTAAACAAAATTTAATCAGTCCT
AAAAATGGTGAGTCAATTATTGCATTGATTTAGGATTTCTTAACTACTGCTTATTTAATC
ACTCATAAAGATATGTTTTTTGATAGAGCTGCTTTTTGCTAATGCTGTACTTACTTCAGT
GATGGTATTGAAAGAATTGATTTGCCTCCTCCAGCTATCATACTTCCTGTTGAAATGTGG
ACTGGAAAATAAATTATAGATGTCATCCTAAGACCTAATAGATTTAGCAATATTATTGTT
AATCTTATATTAAAAGAAAAATGCTACGATACTAAGTAAGATAGAGGTGTTATGTGTCCC
ACTGATGGTTATGTAGTCTTTCAATCATCTGAATTAATGTGTGGTAATCTTGGTAAAACT
ACTTTAGGTTCTGGTAATAAAAATGGTTTGTTTTACAGATTAAGTAGAGATAATTCTCAA
TACATGGCTGCATCAGTCATGAGTAGATTTGCAAAATTGTCTGCTCGTTGGATTACAAAT
TATGGCATGACAATTGGTATTAGTGATGTTACTCCTTCTCCAAGTCTCAACAAAATTAAT
GAAAAAAAGAAAGATGAAGCCATCGATTCTTGTAAGTTCCAAAGTCTTATTTTCACAAAT
TCTATTGGAAAACTAGATATGCAAACTGTTTCAGACAGAAAAAAGCTTGTAGAAGCTGAA
ATTAGTAAAACTTTGAATCAAGTCAGAGAAGACATAGGTTCAAATTGTAATAAGTAATTA
CCACCTACTAATGGTCCTCTTATTATGGCTACATGTGGTTCAAAGGGTTCAGCAACCAAC
CTTTCTTAAATGATTGGATGTGTCGGTTAATAAATTATTGGTGGTCGAAGAGTTCCTAAT
GGCTTTACTGGGCGTACTCTTCCTCATTTTGAAAAAGATGAAATATTCCCTCATCCAGAA
GCTATGGGTTTCGTTAGAAATTCCTTCTTTACTGGTTTAAGTGCACCAGAATTTTTCTTC
CACACAATGGCTGGTCGTGAATCTCTTGTTGATACTGCTGTCAAAACTGCAGATACAGGT
TATATGAGTAGAAGATTGGTTAAGATGCTTGAAGATTTATCTGTAAACTATGATCTTACA
ATTAGAACTTGTGATAAAAAAGAATTAGTTCAGTTTAGATATGGTGGTGATGGTATTTGT
CCTTGGATGTCAGAAGAAAAAGTAACTGATAAAAGTATTCCAATAGATCTTGAAACTATG
TTAAAATATGTCAAATCAATAGCTCCCATAAATTATAAGAGAGAGTAATCCTTGTATCCT
TATTAAATTTATCAAATCTGTTTGGAAGAATTAAAAAGAACAAAAATGGATTATATTCCA
GAATTAAGTTTAGAACCTATGTAAAACTCATCTTATAATAGAGAATTCGACTAAGATTAC
ATACAATAATAATTGAATAGTACAGATAACAAGTTTGATGTCCAACTAGTAAAAGAGCCC
TTAGAGTACTTTAAAGACTCAGTAAGTCTATTTATCAAGTAGATATGCTAAAAAATTATG
AAAGTGAGAACTTAACTTGGATTAACTCCTGGTGATATTGAGTCACCTGATAATGCTACT
AGCATCCATGTTGATAATACAATTCATATTACTAAAAGACAAATTAATTACTTCTTTAAA
ACTTTGTGGGAAAGATATCCATAGATGCTTGTTGAACCAGGAGAGGCTGTAGGTGCAGTT
GGTGCAACATCAATATCTGAACCAGCTACTTAAATGACTTTAAAATCTTTTCACTTTGCT
GGTGTTGCGAGTATGAATATTACATAGGGTGTTCCAAGAATGAAAGAAATCATTGATGCT
GCTAAGAAAATTAGCACTCCAATCATAGATGTTAAGTTGCTTCCTCAATTTTAGAGTGAG
CACTCTTATAGATCAATTCGTTTACAAATAGAAAAAACTTATCTTGGTGAAATCAGTAAC
TTCTATCAAGAAGTTTACTCTCCTAAAGATTGCCACCTTTACATAGAGTATAATAAGAAA
AAATTGGAATAATTCAGACTTTATGGATTAGAAATACCTTTATCAAGCATTAAAAAAGGT
ATTCTTGAAATTGCTAAAGATATAAAGGAAGATTAAATTATTGCCGTAAAGGATTAAGAT
CTCAAGCCTGTTGGTATTAAAATCAACCCAGGTAATGATGTCAAGAAGAACGTGTTCTTT
AAAATTTAAAACTGGAAAAAGATACTTCCAGGAGCTGTTGTTTCAGGTATGAAGGATGTA
AAGAGAGTAAGTATCTCAAAAGACAAGAAGAAGGGAGATAAAAATGAGTACAAATTCGAT
TTGTTTGTTGAAGGTAATTCTTTTAAATAAGTTTTACAACTTGATGAGGTAGATTTTGCA
AATACTCTTTCTGTTGATATTTTCGAAGTATTACAAATTTTGGGTGTAGAAGCTGCAAGA
AAGACAATTATAAATGAAATTACTAAAACTATCAAATCCCACTCTCTTAATGTCGATAGA
CGTCACTTGATTTTAGTTGCCGATGTCCTTACTTCTAAGGGTCGCTTACATGGCTCAACC
AGATAGGGAATCAATAGTATGAAAGACTCAACTTTGATGTTGGCTTCATTCGAAAAAACT
ACTGAAATCTTATACAACGCTGCCTTATAGGGAAGAAAAGACACTTTAGAAGGTGTATCT
GAAAGAATTATTATTGGTCAAAATATTCCTATGGGAACAGGTACATTTAATTTGCTTTAT
GGAAACAGAAGTATTGTTCAGAAAAAGAAGAAGAAAATTATATCTTCTAAAGTTAAATTT
ACTCCTCTTTTTAAAGATTCAAAATGA


>TTHERM_00037340(protein)
MQMSVIQPLRQLKETKRIGSIQYSILSTNEIIDMSEVCLDEPSFYNQTTRAPLNRGPLDL
RMGPSMRENNLKCQTCNQEMLECPGHFGFIKLALPIFHIGFFGDVINILQCICKSCGKVL
LDEDEKKNSMKRMQKAIDDKNYQLRADLYVKMRKECKKGANQKCRSCGYKNGPLKKMPKM
PTTISFSDQTKLEQDFRDIRESEDIFQENLRKILESKNMKEMIEILNPLETYKIFRKITC
DEILLFNIQQNHPCDLILTHIIAPPACIRPTVKEGESNVRHDDLTVKIRDFLDRNKRIAQ
MIEDGEDLIKINQEWFLLQCSHAHYLNAETPNLPFKMDKDFGKKDIRALAQRLKGKKGRF
RGNLSGKRSNFTGRTVISPDPNIPIDNVVVPEYMAKILTFPEQVNAINIERLKKLVINGP
EKYPGAHYIIAKDTEDKFNLSIDNRRKKADELKIGDIVERHIQNGEILLFNRQPSLHRIS
IMAFKANIQKWNTIRFNECCCAPFNADFDGDEMNIHVPQTIEARAEAQYLLDVKQNLISP
KNGESIIALIQDFLTTAYLITHKDMFFDRAAFCQCCTYFSDGIERIDLPPPAIILPVEMW
TGKQIIDVILRPNRFSNIIVNLILKEKCYDTKQDRGVMCPTDGYVVFQSSELMCGNLGKT
TLGSGNKNGLFYRLSRDNSQYMAASVMSRFAKLSARWITNYGMTIGISDVTPSPSLNKIN
EKKKDEAIDSCKFQSLIFTNSIGKLDMQTVSDRKKLVEAEISKTLNQVREDIGSNCNKQL
PPTNGPLIMATCGSKGSATNLSQMIGCVGQQIIGGRRVPNGFTGRTLPHFEKDEIFPHPE
AMGFVRNSFFTGLSAPEFFFHTMAGRESLVDTAVKTADTGYMSRRLVKMLEDLSVNYDLT
IRTCDKKELVQFRYGGDGICPWMSEEKVTDKSIPIDLETMLKYVKSIAPINYKREQSLYP
YQIYQICLEELKRTKMDYIPELSLEPMQNSSYNREFDQDYIQQQLNSTDNKFDVQLVKEP
LEYFKDSVSLFIKQICQKIMKVRTQLGLTPGDIESPDNATSIHVDNTIHITKRQINYFFK
TLWERYPQMLVEPGEAVGAVGATSISEPATQMTLKSFHFAGVASMNITQGVPRMKEIIDA
AKKISTPIIDVKLLPQFQSEHSYRSIRLQIEKTYLGEISNFYQEVYSPKDCHLYIEYNKK
KLEQFRLYGLEIPLSSIKKGILEIAKDIKEDQIIAVKDQDLKPVGIKINPGNDVKKNVFF
KIQNWKKILPGAVVSGMKDVKRVSISKDKKKGDKNEYKFDLFVEGNSFKQVLQLDEVDFA
NTLSVDIFEVLQILGVEAARKTIINEITKTIKSHSLNVDRRHLILVADVLTSKGRLHGST
RQGINSMKDSTLMLASFEKTTEILYNAALQGRKDTLEGVSERIIIGQNIPMGTGTFNLLY
GNRSIVQKKKKKIISSKVKFTPLFKDSK


>TTHERM_00037340(gene)
AATAAATATAAATTGGTTGATCAAAATATCTTTGTCTAACAAATAAATAAATTAATTAAT
AATTACTTATTTCATATATACATTGAATAAGATAAATAAACTTAGCATATAAATATACAT
ATATACATCTATATAGTTAATAGTATAAACAAGGATATAATTAATCAATCATTAAAGTCT
AGTATAGAATCAATCAATTTGCTACATGTAAATGAGCGTTATTTAGCCTTTGAGGTAGTT
AAAGGAGACTAAAAGAATGTAAATATTAGAATCGAGTTCATAAATCTTACATTTTTTTAT
TTTTTAATTCGTTTGCCAAATATATTTTAAGATGATTGAAAATTGAATTAAATGATAAAA
TTCATTCACTAATCTTTCAAAATGCTAATTTGTTTATTTTTTTATTTAAAACATATATTA
GTGGTAGCATCCAATACAGTATCTTATCTACTAATGAAATTATAGATATGTCTGAAGTGT
GCCTTGATGAGCCTTCTTTTTATAATTAAACTACTCGTGCACCTTTAAATCGTGGTCCCT
TAGATTTAAGAATGGTAGAATATTGAATTAGTTTAGGAAATAAGCTTTTAAAAAAACAAA
CAAATAAACCATTTGGCAAATATTTTAAATTGATAAGAAACACATATGATGGTTAAATTA
TTGAAAATATTGTTTAGAAAATTTATTTTATTAAATTAATTTGCTTTATTTAGCATTTTT
ACATTTTAATATAAATTATAATAAAGGGTCCTTCAATGCGTGAAAATAATTTGAAATGTC
AAACATGTAATTAAGAAATGTTGGAATGTCCAGGTCATTTTGGTTTTATTAAATTGGCTC
TACCAATATTCCATATAGGTTTTTTTGGTGATGTCATTAACATCCTTTAATGTATTTGCA
AGGTAAAAAGCATTTCTTACTTCTCCTAATAGATTAAAAAGATAAATATATTTAATTACT
CAATTCTTCTCCTAATTGATAATTTAAAGTGTCTCTGAAATGACAAGAACTAATAAATGA
ATATTCTATTGATTGATTGATTTATTTATTTATTTAAATTTATTTTTACAATAAAAATAG
AGTTGTGGTAAGGTTTTGCTGGATGAAGATGAAAAGAAGAACTCAATGAAAAGAATGCAA
AAAGCTATTGATGACAAAAATTATCAATTAAGAGCTGATTTGTATGTAAAAATGAGAAAA
GAATGCAAAAAAGGTGCCAACTAAAAATGTAGGTCTTGTGGATATAAAAACGGACCCTTA
AAGAAAATGCCTAAAATGCCTACAACTATTAGTTTTTCTGATCAAACCAAATTAGAATAG
GATTTTCGTGACATTAGAGAATCTGAAGACATATTTTAAGAGGTATTTATAAGACTTGTC
TAGATTGACATTTTTAGTTTGTTAAAGATGAATTTTTAGAAATTATTAAATTTGAAGATT
TATTTATTTATTTATGGTTAATATTTAATAAACTTATTTTATAAAATATGATAGAATTTA
AGAAAAATTTTGGAAAGTAAAAATATGAAGGAAATGATTGAAATATTAAATCCTTTAGAA
ACCTATAAAATTTTCAGAAAAATTACATGTGATGAAATTTTATTATTTAATATTCAATAA
AACCATCCTTGTGATTTAATTCTCACTCATATCATAGCACCCCCAGCTTGTATAAGACCA
ACTGTTAAAGAAGGAGAATCTAATGTTCGTCACGATGATCTCACTGTTAAAATTAGAGAT
TTTTTGGACAGAAATAAAAGGTGAATTTAATAATCATTGTAATTGAAAAAATAAATTAAA
TATTATAAAAATTAAAGAATTGCTTAGATGATAGAAGATGGTGAAGATTTAATTAAAATT
AACTAAGAGTGGTTCTTACTTTAGTGTTCACATGCTCACTATTTGAATGCTGAAACTCCA
AACTTGCCTTTTAAAATGGACAAAGATTTTGGTAAAAAGGATATTAGAGCACTTGCACAA
AGATTAAAAGGTAAAAAAGGTAGATTCAGAGGTAATCTTTCTGGTAAAAGATCAAACTTT
ACAGGTAGAACTGTTATTTCTCCTGACCCTAACATCCCTATTGATAATGTAAGATATCTT
TAATATTATCTCATATAATTTTATAAACCAAATAACAAAGGTTGTTGTTCCTGAATACAT
GGCTAAAATTCTCACTTTCCCTGAATAAGTTAATGCTATCAATATCGAAAGATTAAAAAA
ATTAGTTATAAATGGACCTGAAAAATATCCAGGAGCTCATTATATAATAGCAAAAGACAC
AGAAGACAAATTTAATCTATCAATAGATAATAGAAGAAAGAAAGCAGATGAACTCAAGAT
TGGTGATATTGTAGAAAGACACATCCAAAACGGAGAAATTTTACTTTTTAATAGACAGCC
TTCTTTGCATAGAATTTCAATTATGGCATTCAAGTGAGTTAACATTTTTTAATTTTAAAC
AATTGTTAAACTTGATTTATAAAATAGGGCCAATATATAAAAATGGAATACAATCAGATT
TAATGAATGTTGCTGTGCTCCTTTCAATGCTGATTTTGATGGTGATGAAATGAATATTCA
TGTTCCATAAACAATAGAAGCAAGAGCTGAGGCCTAATATCTCCTTGATGTTAAACAAAA
TTTAATCAGTCCTAAAAATGGTGAGGTAAATAAAAATTAAAACCATTGTGAAATAGATAT
AACCTGTCTATTGATTGCGAAATAAAATGATATCATTTTAATAAAAAAATATAAATAAAA
TAAATTTAAGATTATTGAATTATTTTATAAAGTGATTAATTTAAAAATTTTGTATATAAA
AGTCAATTATTGCATTGATTTAGGATTTCTTAACTACTGCTTATTTAATCACTCATAAAG
ATATGTTTTTTGATAGAGCTGCTTTTTGCTAATGCTGTACTTACTTCAGTGATGGTATTG
AAAGAATTGATTTGCCTCCTCCAGCTATCATACTTCCTGTTGGTATGAAATATTATTTAT
TAAATATATTTTAATCTTAAATTTATTAATAAAAAGAAATGTGGACTGGAAAATAAATTA
TAGATGTCATCCTAAGACCTAATAGATTTAGCAATATTATTGTTAATCTTATATTAAAAG
AAAAATGCTACGATACTAAGTAAGATAGAGGTGTTATGTGTCCCACTGATGGTTATGTAG
TCTTTCAATCATCTGAATTAATGTGTGGTAATCTTGGTAAAACTACTTTAGGTTCTGGTA
ATAAAAATGGTTTGTTTTACAGATTAAGTAGAGATAATTCTCAATACATGGCTGCATCAG
TCATGAGTAGATTTGCAAAATTGTCTGCTCGTTGGATTACAAATTATGGCATGACAATTG
GTATTAGTGATGTTACTCCTTCTCCAAGTCTCAACAAAATTAATGAAAAAAAGAAAGATG
AAGCGTAAAAGAATTTTATTTATTTATTTAGCTTAAAATAAATTTTTTTAAAATATTTGT
AAACAGCATCGATTCTTGTAAGTTCCAAAGTCTTATTTTCACAAATTCTATTGGAAAACT
AGATATGCAAACTGTTTCAGACAGAAAAAAGCTTGTAGAAGCTGAAATTAGTAAAACTTT
GAATCAAGTCAGAGAAGACATAGGTTCAAATTGTAATAAGTAATTACCACCTACTAATGG
TCCTCTTATTATGGCTACATGTGGTTCAAAGGGTTCAGCAACCAACCTTTCTTAAATGAT
TGGATGTGTCGGTTAATAAATTATTGGTGGTCGAAGAGTTCCTAATGGCTTTACTGGGCG
TACTCTTCCTCATTTTGAAAAAGATGAAATATTCCCTCATCCAGAAGCTATGGGTTTCGT
TAGAAATTCCTTCTTTACTGGTTTAAGTGCACCAGAATTTTTCTTCCACACAATGGCTGG
TCGTGAATCTCTTGTTGATACTGCTGTCAAAACTGCAGATACAGGGTAAAAAAAATATGT
TTATAAAAATAAAATTAATCATTTATTTTTTATAATACTTAGTTATATGAGTAGAAGATT
GGTTAAGATGCTTGAAGATTTATCTGTAAACTATGATCTTACAATTAGAACTTGTGATAA
AAAAGAATTAGTTCAGTTTAGATATGGTGGTGATGGTATTTGTCCTTGGATGTCAGAAGA
AAAAGTAACTGATAAAAGTATTCCAATAGATCTTGAAACTATGTTAAAATATGTCAAATC
AATAGCTCCCATAAATTATAAGAGAGAGTAATCCTTGTATCCTTATTAAATTTATCAAAT
CTGTTTGGAAGAATTAAAAAGAACAAAAATGGATTATATTCCAGAATTAAGTTTAGAACC
TATGTAAAACTCATCTTATAATAGAGAATTCGACTAAGATTACATACAATAATAATTGAA
TAGTACAGATAACAAGTTTGATGTCCAACTAGTATTTTATATTTTATAATCAAATAACTA
AATTTAATCATATTTTCATTTAATCCATAAGGTAAAAGAGCCCTTAGAGTACTTTAAAGA
CTCAGTAAGTCTATTTATCAAGTAGATATGCTAAAAAATTATGAAAGTGAGAACTTAACT
TGGATTAACTCCTGGTGATATTGAGTCACCTGATAATGCTACTAGCATCCATGTTGATAA
TACAATTCATATTACTAAAAGACAAATTAATTACTTCTTTAAAACTTTGTGGGAAAGATA
TCCATAGATGCTTGTTGAACCAGGAGAGGCTGTAGGTGCAGTTGGTGCAACATCAATATC
TGAACCAGCTACTTAAATGACTTTAAAATCTTTTCAGTAACAATTTTTCCATTCAAAATA
CTTAAATATAAAAATTTCTAATATTAAAAAATTTGACAATTGCTCAATTTCCTTAAAATT
TATAAAACTTTTCTATCATTAAAATCGATTATTATTTTTTGAATTTAAAATCAAAAACAA
ATGATAAAAATAATATCATAAAAATTAAAAAAAATAAATATTATGTTTTTAAACAAAATA
AATATTCAGACAATTAACAATTAGATAAATAGAAATACATATTTGATCACTAATAAAATT
ATTATCTAATTTGGTTTTAATTATTAATGATTTAATTTTTGAATGGAAAGTAATCACAAA
GCTTAAAAGATAAAATTTTCCAATAAAATTACAAATTTAGAATAAAAATAAACTAAATAA
AAATATGTATAAGTTTAAATAGTTTTTGTATGAAAAAAAAAAAATTTCTGAAAAATCTTA
AATTAATCAATTAATTTGTTGGTTATATTAAAGATGAATTAAAATTATTTTTAATAATTA
ATACTTATTTATGTAAATAAATGTTATATAAAATAGCTTTGCTGGTGTTGCGAGTATGAA
TATTACATAGGGTGTTCCAAGAATGAAAGAAATCATTGATGCTGCTAAGAAAATTAGCAC
TCCAATCATAGATGTTAAGTTGCTTCCTCAATTTTAGAGTGAGCACTCTTATAGATCAAT
TCGTTTACAAATAGAAAAAACTTATCTTGGTGAAATCAGTAACTTCTATCAAGAAGTTTA
CTCTCCTAAAGATTGCCACCTTTACATAGAGTATAATAAGAAAAAATTGGAATAATTCAG
ACTTTATGGATTAGAAATACCTTTATCAAGCATTAAAAAAGGTAACTTTGCAATTGATAT
TTATAGGTTATTAATTTAAAATTTTAATTTTAGGTATTCTTGAAATTGCTAAAGATATAA
AGGAAGATTAAATTATTGCCGTAAAGGATTAAGATCTCAAGCCTGTTGGTATTAAAATCA
ACCCAGGTAATGATGTCAAGAAGAACGTGTTCTTTAAAATTTAAAACTGGAAAAAGATAC
TTCCAGGAGCTGTTGTTTCAGGTATGAAGGATGTAAAGAGAGTAAGTATCTCAAAAGACA
AGAAGAAGGGAGATAAAAATGAGTACAAATTCGATTTGTTTGTTGAAGGTAATTCTTTTA
AATAAGTTTTACAACTTGATGAGGTAGATTTTGCAAATACTCTTTCTGTTGATATTTTCG
AAGTATTACAAATTTTGGGTGTAGAAGCTGCAAGAAAGACAATTATAAATGAAATTACTA
AAACTATCAAATCCCACTCTCTTAATGTCGATAGACGTCACTTGATTTTAGTTGCCGATG
TCCTTACTTCTAAGGGTAATTTTTATTTTTTACAGAGTATATTTTTTTATTTTGAAATAT
AATCTTCATTTTAAAAAAGGTCGCTTACATGGCTCAACCAGATAGGGAATCAATAGTATG
AAAGACTCAACTTTGATGTTGGCTTCATTCGAAAAAACTACTGAAATCTTATACAACGCT
GCCTTATAGGGAAGAAAAGACACTTTAGAAGGTGTATCTGAAAGAATTATTATTGGTCAA
AATATTCCTATGGGAACAGGTACATTTAATTTGCTTTATGGAAACAGAAGTATTGTTCAG
AAAAAGAAGAAGAAAATTATATCTTCTAAAGTTAAATTTACTCCTCTTTTTAAAGATTCA
AAATGAAGAAATTGTGTTAAATGCTAGTTAGCTGTTTAAAATATTTAATTTTATAAATGC
TCCTATTTCAAAATAATTTATTATTGTATGTATTGTTCCGCTCTTTAATAATTTAACATA
ATTCTTTGAAGTATTTCAAAGTAACAAATAACTTTCAC