Identifiers and Description

Gene Model Identifier

TTHERM_00037340

Standard Name

RPC1 (RNA polymerase III largest subunit Rpc1)

Aliases

PreTt14469 | 2.m02145 | 3825.m02839

Description

RPC1 DNA-directed RNA polymerase; RNA polymerase III largest subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00037340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_377350
WormBaseWBGene000044119.997093137033517e-262locus:rpc-1 DNA-directed RNA
polymerase status:Partially
_confirmed UniProt:Q18566
protein_id:CCD66619.1
Tetrahymena borealisEI9_00989.19.997093137033517e-262RNA polymerase Rpb1, domain 2
family protein (1437 aa)
DictyBaseDDB_G02771999.997093137033517e-262rpc1 on chromosome: 2 position
7733653 to 7738100
OxytrichaContig21914.0.g479.997093137033517e-262RNA polymerase Rpb1, domain 5
SGDYOR116C9.997093137033517e-262RPO31 RNA polymerase III large
st subunit C160, part of core
enzyme; similar to bacterial b
eta-prime subunit and to RPA19
0 and RPO21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00037340(coding)
ATGTAAATGAGCGTTATTTAGCCTTTGAGGTAGTTAAAGGAGACTAAAAGAATTGGTAGC
ATCCAATACAGTATCTTATCTACTAATGAAATTATAGATATGTCTGAAGTGTGCCTTGAT
GAGCCTTCTTTTTATAATTAAACTACTCGTGCACCTTTAAATCGTGGTCCCTTAGATTTA
AGAATGGGTCCTTCAATGCGTGAAAATAATTTGAAATGTCAAACATGTAATTAAGAAATG
TTGGAATGTCCAGGTCATTTTGGTTTTATTAAATTGGCTCTACCAATATTCCATATAGGT
TTTTTTGGTGATGTCATTAACATCCTTTAATGTATTTGCAAGAGTTGTGGTAAGGTTTTG
CTGGATGAAGATGAAAAGAAGAACTCAATGAAAAGAATGCAAAAAGCTATTGATGACAAA
AATTATCAATTAAGAGCTGATTTGTATGTAAAAATGAGAAAAGAATGCAAAAAAGGTGCC
AACTAAAAATGTAGGTCTTGTGGATATAAAAACGGACCCTTAAAGAAAATGCCTAAAATG
CCTACAACTATTAGTTTTTCTGATCAAACCAAATTAGAATAGGATTTTCGTGACATTAGA
GAATCTGAAGACATATTTTAAGAGAATTTAAGAAAAATTTTGGAAAGTAAAAATATGAAG
GAAATGATTGAAATATTAAATCCTTTAGAAACCTATAAAATTTTCAGAAAAATTACATGT
GATGAAATTTTATTATTTAATATTCAATAAAACCATCCTTGTGATTTAATTCTCACTCAT
ATCATAGCACCCCCAGCTTGTATAAGACCAACTGTTAAAGAAGGAGAATCTAATGTTCGT
CACGATGATCTCACTGTTAAAATTAGAGATTTTTTGGACAGAAATAAAAGAATTGCTTAG
ATGATAGAAGATGGTGAAGATTTAATTAAAATTAACTAAGAGTGGTTCTTACTTTAGTGT
TCACATGCTCACTATTTGAATGCTGAAACTCCAAACTTGCCTTTTAAAATGGACAAAGAT
TTTGGTAAAAAGGATATTAGAGCACTTGCACAAAGATTAAAAGGTAAAAAAGGTAGATTC
AGAGGTAATCTTTCTGGTAAAAGATCAAACTTTACAGGTAGAACTGTTATTTCTCCTGAC
CCTAACATCCCTATTGATAATGTTGTTGTTCCTGAATACATGGCTAAAATTCTCACTTTC
CCTGAATAAGTTAATGCTATCAATATCGAAAGATTAAAAAAATTAGTTATAAATGGACCT
GAAAAATATCCAGGAGCTCATTATATAATAGCAAAAGACACAGAAGACAAATTTAATCTA
TCAATAGATAATAGAAGAAAGAAAGCAGATGAACTCAAGATTGGTGATATTGTAGAAAGA
CACATCCAAAACGGAGAAATTTTACTTTTTAATAGACAGCCTTCTTTGCATAGAATTTCA
ATTATGGCATTCAAGGCCAATATATAAAAATGGAATACAATCAGATTTAATGAATGTTGC
TGTGCTCCTTTCAATGCTGATTTTGATGGTGATGAAATGAATATTCATGTTCCATAAACA
ATAGAAGCAAGAGCTGAGGCCTAATATCTCCTTGATGTTAAACAAAATTTAATCAGTCCT
AAAAATGGTGAGTCAATTATTGCATTGATTTAGGATTTCTTAACTACTGCTTATTTAATC
ACTCATAAAGATATGTTTTTTGATAGAGCTGCTTTTTGCTAATGCTGTACTTACTTCAGT
GATGGTATTGAAAGAATTGATTTGCCTCCTCCAGCTATCATACTTCCTGTTGAAATGTGG
ACTGGAAAATAAATTATAGATGTCATCCTAAGACCTAATAGATTTAGCAATATTATTGTT
AATCTTATATTAAAAGAAAAATGCTACGATACTAAGTAAGATAGAGGTGTTATGTGTCCC
ACTGATGGTTATGTAGTCTTTCAATCATCTGAATTAATGTGTGGTAATCTTGGTAAAACT
ACTTTAGGTTCTGGTAATAAAAATGGTTTGTTTTACAGATTAAGTAGAGATAATTCTCAA
TACATGGCTGCATCAGTCATGAGTAGATTTGCAAAATTGTCTGCTCGTTGGATTACAAAT
TATGGCATGACAATTGGTATTAGTGATGTTACTCCTTCTCCAAGTCTCAACAAAATTAAT
GAAAAAAAGAAAGATGAAGCCATCGATTCTTGTAAGTTCCAAAGTCTTATTTTCACAAAT
TCTATTGGAAAACTAGATATGCAAACTGTTTCAGACAGAAAAAAGCTTGTAGAAGCTGAA
ATTAGTAAAACTTTGAATCAAGTCAGAGAAGACATAGGTTCAAATTGTAATAAGTAATTA
CCACCTACTAATGGTCCTCTTATTATGGCTACATGTGGTTCAAAGGGTTCAGCAACCAAC
CTTTCTTAAATGATTGGATGTGTCGGTTAATAAATTATTGGTGGTCGAAGAGTTCCTAAT
GGCTTTACTGGGCGTACTCTTCCTCATTTTGAAAAAGATGAAATATTCCCTCATCCAGAA
GCTATGGGTTTCGTTAGAAATTCCTTCTTTACTGGTTTAAGTGCACCAGAATTTTTCTTC
CACACAATGGCTGGTCGTGAATCTCTTGTTGATACTGCTGTCAAAACTGCAGATACAGGT
TATATGAGTAGAAGATTGGTTAAGATGCTTGAAGATTTATCTGTAAACTATGATCTTACA
ATTAGAACTTGTGATAAAAAAGAATTAGTTCAGTTTAGATATGGTGGTGATGGTATTTGT
CCTTGGATGTCAGAAGAAAAAGTAACTGATAAAAGTATTCCAATAGATCTTGAAACTATG
TTAAAATATGTCAAATCAATAGCTCCCATAAATTATAAGAGAGAGTAATCCTTGTATCCT
TATTAAATTTATCAAATCTGTTTGGAAGAATTAAAAAGAACAAAAATGGATTATATTCCA
GAATTAAGTTTAGAACCTATGTAAAACTCATCTTATAATAGAGAATTCGACTAAGATTAC
ATACAATAATAATTGAATAGTACAGATAACAAGTTTGATGTCCAACTAGTAAAAGAGCCC
TTAGAGTACTTTAAAGACTCAGTAAGTCTATTTATCAAGTAGATATGCTAAAAAATTATG
AAAGTGAGAACTTAACTTGGATTAACTCCTGGTGATATTGAGTCACCTGATAATGCTACT
AGCATCCATGTTGATAATACAATTCATATTACTAAAAGACAAATTAATTACTTCTTTAAA
ACTTTGTGGGAAAGATATCCATAGATGCTTGTTGAACCAGGAGAGGCTGTAGGTGCAGTT
GGTGCAACATCAATATCTGAACCAGCTACTTAAATGACTTTAAAATCTTTTCACTTTGCT
GGTGTTGCGAGTATGAATATTACATAGGGTGTTCCAAGAATGAAAGAAATCATTGATGCT
GCTAAGAAAATTAGCACTCCAATCATAGATGTTAAGTTGCTTCCTCAATTTTAGAGTGAG
CACTCTTATAGATCAATTCGTTTACAAATAGAAAAAACTTATCTTGGTGAAATCAGTAAC
TTCTATCAAGAAGTTTACTCTCCTAAAGATTGCCACCTTTACATAGAGTATAATAAGAAA
AAATTGGAATAATTCAGACTTTATGGATTAGAAATACCTTTATCAAGCATTAAAAAAGGT
ATTCTTGAAATTGCTAAAGATATAAAGGAAGATTAAATTATTGCCGTAAAGGATTAAGAT
CTCAAGCCTGTTGGTATTAAAATCAACCCAGGTAATGATGTCAAGAAGAACGTGTTCTTT
AAAATTTAAAACTGGAAAAAGATACTTCCAGGAGCTGTTGTTTCAGGTATGAAGGATGTA
AAGAGAGTAAGTATCTCAAAAGACAAGAAGAAGGGAGATAAAAATGAGTACAAATTCGAT
TTGTTTGTTGAAGGTAATTCTTTTAAATAAGTTTTACAACTTGATGAGGTAGATTTTGCA
AATACTCTTTCTGTTGATATTTTCGAAGTATTACAAATTTTGGGTGTAGAAGCTGCAAGA
AAGACAATTATAAATGAAATTACTAAAACTATCAAATCCCACTCTCTTAATGTCGATAGA
CGTCACTTGATTTTAGTTGCCGATGTCCTTACTTCTAAGGGTCGCTTACATGGCTCAACC
AGATAGGGAATCAATAGTATGAAAGACTCAACTTTGATGTTGGCTTCATTCGAAAAAACT
ACTGAAATCTTATACAACGCTGCCTTATAGGGAAGAAAAGACACTTTAGAAGGTGTATCT
GAAAGAATTATTATTGGTCAAAATATTCCTATGGGAACAGGTACATTTAATTTGCTTTAT
GGAAACAGAAGTATTGTTCAGAAAAAGAAGAAGAAAATTATATCTTCTAAAGTTAAATTT
ACTCCTCTTTTTAAAGATTCAAAATGA


>TTHERM_00037340(protein)
MQMSVIQPLRQLKETKRIGSIQYSILSTNEIIDMSEVCLDEPSFYNQTTRAPLNRGPLDL
RMGPSMRENNLKCQTCNQEMLECPGHFGFIKLALPIFHIGFFGDVINILQCICKSCGKVL
LDEDEKKNSMKRMQKAIDDKNYQLRADLYVKMRKECKKGANQKCRSCGYKNGPLKKMPKM
PTTISFSDQTKLEQDFRDIRESEDIFQENLRKILESKNMKEMIEILNPLETYKIFRKITC
DEILLFNIQQNHPCDLILTHIIAPPACIRPTVKEGESNVRHDDLTVKIRDFLDRNKRIAQ
MIEDGEDLIKINQEWFLLQCSHAHYLNAETPNLPFKMDKDFGKKDIRALAQRLKGKKGRF
RGNLSGKRSNFTGRTVISPDPNIPIDNVVVPEYMAKILTFPEQVNAINIERLKKLVINGP
EKYPGAHYIIAKDTEDKFNLSIDNRRKKADELKIGDIVERHIQNGEILLFNRQPSLHRIS
IMAFKANIQKWNTIRFNECCCAPFNADFDGDEMNIHVPQTIEARAEAQYLLDVKQNLISP
KNGESIIALIQDFLTTAYLITHKDMFFDRAAFCQCCTYFSDGIERIDLPPPAIILPVEMW
TGKQIIDVILRPNRFSNIIVNLILKEKCYDTKQDRGVMCPTDGYVVFQSSELMCGNLGKT
TLGSGNKNGLFYRLSRDNSQYMAASVMSRFAKLSARWITNYGMTIGISDVTPSPSLNKIN
EKKKDEAIDSCKFQSLIFTNSIGKLDMQTVSDRKKLVEAEISKTLNQVREDIGSNCNKQL
PPTNGPLIMATCGSKGSATNLSQMIGCVGQQIIGGRRVPNGFTGRTLPHFEKDEIFPHPE
AMGFVRNSFFTGLSAPEFFFHTMAGRESLVDTAVKTADTGYMSRRLVKMLEDLSVNYDLT
IRTCDKKELVQFRYGGDGICPWMSEEKVTDKSIPIDLETMLKYVKSIAPINYKREQSLYP
YQIYQICLEELKRTKMDYIPELSLEPMQNSSYNREFDQDYIQQQLNSTDNKFDVQLVKEP
LEYFKDSVSLFIKQICQKIMKVRTQLGLTPGDIESPDNATSIHVDNTIHITKRQINYFFK
TLWERYPQMLVEPGEAVGAVGATSISEPATQMTLKSFHFAGVASMNITQGVPRMKEIIDA
AKKISTPIIDVKLLPQFQSEHSYRSIRLQIEKTYLGEISNFYQEVYSPKDCHLYIEYNKK
KLEQFRLYGLEIPLSSIKKGILEIAKDIKEDQIIAVKDQDLKPVGIKINPGNDVKKNVFF
KIQNWKKILPGAVVSGMKDVKRVSISKDKKKGDKNEYKFDLFVEGNSFKQVLQLDEVDFA
NTLSVDIFEVLQILGVEAARKTIINEITKTIKSHSLNVDRRHLILVADVLTSKGRLHGST
RQGINSMKDSTLMLASFEKTTEILYNAALQGRKDTLEGVSERIIIGQNIPMGTGTFNLLY
GNRSIVQKKKKKIISSKVKFTPLFKDSK


>TTHERM_00037340(gene)
ATGTAAATGAGCGTTATTTAGCCTTTGAGGTAGTTAAAGGAGACTAAAAGAATGTAAATA
TTAGAATCGAGTTCATAAATCTTACATTTTTTTATTTTTTAATTCGTTTGCCAAATATAT
TTTAAGATGATTGAAAATTGAATTAAATGATAAAATTCATTCACTAATCTTTCAAAATGC
TAATTTGTTTATTTTTTTATTTAAAACATATATTAGTGGTAGCATCCAATACAGTATCTT
ATCTACTAATGAAATTATAGATATGTCTGAAGTGTGCCTTGATGAGCCTTCTTTTTATAA
TTAAACTACTCGTGCACCTTTAAATCGTGGTCCCTTAGATTTAAGAATGGTAGAATATTG
AATTAGTTTAGGAAATAAGCTTTTAAAAAAACAAACAAATAAACCATTTGGCAAATATTT
TAAATTGATAAGAAACACATATGATGGTTAAATTATTGAAAATATTGTTTAGAAAATTTA
TTTTATTAAATTAATTTGCTTTATTTAGCATTTTTACATTTTAATATAAATTATAATAAA
GGGTCCTTCAATGCGTGAAAATAATTTGAAATGTCAAACATGTAATTAAGAAATGTTGGA
ATGTCCAGGTCATTTTGGTTTTATTAAATTGGCTCTACCAATATTCCATATAGGTTTTTT
TGGTGATGTCATTAACATCCTTTAATGTATTTGCAAGGTAAAAAGCATTTCTTACTTCTC
CTAATAGATTAAAAAGATAAATATATTTAATTACTCAATTCTTCTCCTAATTGATAATTT
AAAGTGTCTCTGAAATGACAAGAACTAATAAATGAATATTCTATTGATTGATTGATTTAT
TTATTTATTTAAATTTATTTTTACAATAAAAATAGAGTTGTGGTAAGGTTTTGCTGGATG
AAGATGAAAAGAAGAACTCAATGAAAAGAATGCAAAAAGCTATTGATGACAAAAATTATC
AATTAAGAGCTGATTTGTATGTAAAAATGAGAAAAGAATGCAAAAAAGGTGCCAACTAAA
AATGTAGGTCTTGTGGATATAAAAACGGACCCTTAAAGAAAATGCCTAAAATGCCTACAA
CTATTAGTTTTTCTGATCAAACCAAATTAGAATAGGATTTTCGTGACATTAGAGAATCTG
AAGACATATTTTAAGAGGTATTTATAAGACTTGTCTAGATTGACATTTTTAGTTTGTTAA
AGATGAATTTTTAGAAATTATTAAATTTGAAGATTTATTTATTTATTTATGGTTAATATT
TAATAAACTTATTTTATAAAATATGATAGAATTTAAGAAAAATTTTGGAAAGTAAAAATA
TGAAGGAAATGATTGAAATATTAAATCCTTTAGAAACCTATAAAATTTTCAGAAAAATTA
CATGTGATGAAATTTTATTATTTAATATTCAATAAAACCATCCTTGTGATTTAATTCTCA
CTCATATCATAGCACCCCCAGCTTGTATAAGACCAACTGTTAAAGAAGGAGAATCTAATG
TTCGTCACGATGATCTCACTGTTAAAATTAGAGATTTTTTGGACAGAAATAAAAGGTGAA
TTTAATAATCATTGTAATTGAAAAAATAAATTAAATATTATAAAAATTAAAGAATTGCTT
AGATGATAGAAGATGGTGAAGATTTAATTAAAATTAACTAAGAGTGGTTCTTACTTTAGT
GTTCACATGCTCACTATTTGAATGCTGAAACTCCAAACTTGCCTTTTAAAATGGACAAAG
ATTTTGGTAAAAAGGATATTAGAGCACTTGCACAAAGATTAAAAGGTAAAAAAGGTAGAT
TCAGAGGTAATCTTTCTGGTAAAAGATCAAACTTTACAGGTAGAACTGTTATTTCTCCTG
ACCCTAACATCCCTATTGATAATGTAAGATATCTTTAATATTATCTCATATAATTTTATA
AACCAAATAACAAAGGTTGTTGTTCCTGAATACATGGCTAAAATTCTCACTTTCCCTGAA
TAAGTTAATGCTATCAATATCGAAAGATTAAAAAAATTAGTTATAAATGGACCTGAAAAA
TATCCAGGAGCTCATTATATAATAGCAAAAGACACAGAAGACAAATTTAATCTATCAATA
GATAATAGAAGAAAGAAAGCAGATGAACTCAAGATTGGTGATATTGTAGAAAGACACATC
CAAAACGGAGAAATTTTACTTTTTAATAGACAGCCTTCTTTGCATAGAATTTCAATTATG
GCATTCAAGTGAGTTAACATTTTTTAATTTTAAACAATTGTTAAACTTGATTTATAAAAT
AGGGCCAATATATAAAAATGGAATACAATCAGATTTAATGAATGTTGCTGTGCTCCTTTC
AATGCTGATTTTGATGGTGATGAAATGAATATTCATGTTCCATAAACAATAGAAGCAAGA
GCTGAGGCCTAATATCTCCTTGATGTTAAACAAAATTTAATCAGTCCTAAAAATGGTGAG
GTAAATAAAAATTAAAACCATTGTGAAATAGATATAACCTGTCTATTGATTGCGAAATAA
AATGATATCATTTTAATAAAAAAATATAAATAAAATAAATTTAAGATTATTGAATTATTT
TATAAAGTGATTAATTTAAAAATTTTGTATATAAAAGTCAATTATTGCATTGATTTAGGA
TTTCTTAACTACTGCTTATTTAATCACTCATAAAGATATGTTTTTTGATAGAGCTGCTTT
TTGCTAATGCTGTACTTACTTCAGTGATGGTATTGAAAGAATTGATTTGCCTCCTCCAGC
TATCATACTTCCTGTTGGTATGAAATATTATTTATTAAATATATTTTAATCTTAAATTTA
TTAATAAAAAGAAATGTGGACTGGAAAATAAATTATAGATGTCATCCTAAGACCTAATAG
ATTTAGCAATATTATTGTTAATCTTATATTAAAAGAAAAATGCTACGATACTAAGTAAGA
TAGAGGTGTTATGTGTCCCACTGATGGTTATGTAGTCTTTCAATCATCTGAATTAATGTG
TGGTAATCTTGGTAAAACTACTTTAGGTTCTGGTAATAAAAATGGTTTGTTTTACAGATT
AAGTAGAGATAATTCTCAATACATGGCTGCATCAGTCATGAGTAGATTTGCAAAATTGTC
TGCTCGTTGGATTACAAATTATGGCATGACAATTGGTATTAGTGATGTTACTCCTTCTCC
AAGTCTCAACAAAATTAATGAAAAAAAGAAAGATGAAGCGTAAAAGAATTTTATTTATTT
ATTTAGCTTAAAATAAATTTTTTTAAAATATTTGTAAACAGCATCGATTCTTGTAAGTTC
CAAAGTCTTATTTTCACAAATTCTATTGGAAAACTAGATATGCAAACTGTTTCAGACAGA
AAAAAGCTTGTAGAAGCTGAAATTAGTAAAACTTTGAATCAAGTCAGAGAAGACATAGGT
TCAAATTGTAATAAGTAATTACCACCTACTAATGGTCCTCTTATTATGGCTACATGTGGT
TCAAAGGGTTCAGCAACCAACCTTTCTTAAATGATTGGATGTGTCGGTTAATAAATTATT
GGTGGTCGAAGAGTTCCTAATGGCTTTACTGGGCGTACTCTTCCTCATTTTGAAAAAGAT
GAAATATTCCCTCATCCAGAAGCTATGGGTTTCGTTAGAAATTCCTTCTTTACTGGTTTA
AGTGCACCAGAATTTTTCTTCCACACAATGGCTGGTCGTGAATCTCTTGTTGATACTGCT
GTCAAAACTGCAGATACAGGGTAAAAAAAATATGTTTATAAAAATAAAATTAATCATTTA
TTTTTTATAATACTTAGTTATATGAGTAGAAGATTGGTTAAGATGCTTGAAGATTTATCT
GTAAACTATGATCTTACAATTAGAACTTGTGATAAAAAAGAATTAGTTCAGTTTAGATAT
GGTGGTGATGGTATTTGTCCTTGGATGTCAGAAGAAAAAGTAACTGATAAAAGTATTCCA
ATAGATCTTGAAACTATGTTAAAATATGTCAAATCAATAGCTCCCATAAATTATAAGAGA
GAGTAATCCTTGTATCCTTATTAAATTTATCAAATCTGTTTGGAAGAATTAAAAAGAACA
AAAATGGATTATATTCCAGAATTAAGTTTAGAACCTATGTAAAACTCATCTTATAATAGA
GAATTCGACTAAGATTACATACAATAATAATTGAATAGTACAGATAACAAGTTTGATGTC
CAACTAGTATTTTATATTTTATAATCAAATAACTAAATTTAATCATATTTTCATTTAATC
CATAAGGTAAAAGAGCCCTTAGAGTACTTTAAAGACTCAGTAAGTCTATTTATCAAGTAG
ATATGCTAAAAAATTATGAAAGTGAGAACTTAACTTGGATTAACTCCTGGTGATATTGAG
TCACCTGATAATGCTACTAGCATCCATGTTGATAATACAATTCATATTACTAAAAGACAA
ATTAATTACTTCTTTAAAACTTTGTGGGAAAGATATCCATAGATGCTTGTTGAACCAGGA
GAGGCTGTAGGTGCAGTTGGTGCAACATCAATATCTGAACCAGCTACTTAAATGACTTTA
AAATCTTTTCAGTAACAATTTTTCCATTCAAAATACTTAAATATAAAAATTTCTAATATT
AAAAAATTTGACAATTGCTCAATTTCCTTAAAATTTATAAAACTTTTCTATCATTAAAAT
CGATTATTATTTTTTGAATTTAAAATCAAAAACAAATGATAAAAATAATATCATAAAAAT
TAAAAAAAATAAATATTATGTTTTTAAACAAAATAAATATTCAGACAATTAACAATTAGA
TAAATAGAAATACATATTTGATCACTAATAAAATTATTATCTAATTTGGTTTTAATTATT
AATGATTTAATTTTTGAATGGAAAGTAATCACAAAGCTTAAAAGATAAAATTTTCCAATA
AAATTACAAATTTAGAATAAAAATAAACTAAATAAAAATATGTATAAGTTTAAATAGTTT
TTGTATGAAAAAAAAAAAATTTCTGAAAAATCTTAAATTAATCAATTAATTTGTTGGTTA
TATTAAAGATGAATTAAAATTATTTTTAATAATTAATACTTATTTATGTAAATAAATGTT
ATATAAAATAGCTTTGCTGGTGTTGCGAGTATGAATATTACATAGGGTGTTCCAAGAATG
AAAGAAATCATTGATGCTGCTAAGAAAATTAGCACTCCAATCATAGATGTTAAGTTGCTT
CCTCAATTTTAGAGTGAGCACTCTTATAGATCAATTCGTTTACAAATAGAAAAAACTTAT
CTTGGTGAAATCAGTAACTTCTATCAAGAAGTTTACTCTCCTAAAGATTGCCACCTTTAC
ATAGAGTATAATAAGAAAAAATTGGAATAATTCAGACTTTATGGATTAGAAATACCTTTA
TCAAGCATTAAAAAAGGTAACTTTGCAATTGATATTTATAGGTTATTAATTTAAAATTTT
AATTTTAGGTATTCTTGAAATTGCTAAAGATATAAAGGAAGATTAAATTATTGCCGTAAA
GGATTAAGATCTCAAGCCTGTTGGTATTAAAATCAACCCAGGTAATGATGTCAAGAAGAA
CGTGTTCTTTAAAATTTAAAACTGGAAAAAGATACTTCCAGGAGCTGTTGTTTCAGGTAT
GAAGGATGTAAAGAGAGTAAGTATCTCAAAAGACAAGAAGAAGGGAGATAAAAATGAGTA
CAAATTCGATTTGTTTGTTGAAGGTAATTCTTTTAAATAAGTTTTACAACTTGATGAGGT
AGATTTTGCAAATACTCTTTCTGTTGATATTTTCGAAGTATTACAAATTTTGGGTGTAGA
AGCTGCAAGAAAGACAATTATAAATGAAATTACTAAAACTATCAAATCCCACTCTCTTAA
TGTCGATAGACGTCACTTGATTTTAGTTGCCGATGTCCTTACTTCTAAGGGTAATTTTTA
TTTTTTACAGAGTATATTTTTTTATTTTGAAATATAATCTTCATTTTAAAAAAGGTCGCT
TACATGGCTCAACCAGATAGGGAATCAATAGTATGAAAGACTCAACTTTGATGTTGGCTT
CATTCGAAAAAACTACTGAAATCTTATACAACGCTGCCTTATAGGGAAGAAAAGACACTT
TAGAAGGTGTATCTGAAAGAATTATTATTGGTCAAAATATTCCTATGGGAACAGGTACAT
TTAATTTGCTTTATGGAAACAGAAGTATTGTTCAGAAAAAGAAGAAGAAAATTATATCTT
CTAAAGTTAAATTTACTCCTCTTTTTAAAGATTCAAAATGA