Identifiers and Description

Gene Model Identifier

TTHERM_00245500

Standard Name

RPB9 (RNA polymerase II subunit 9)

Aliases

PreTt02445 | 21.m00276

Description

!!! Two genes, RPB9 and a F-box domian containg gene, are fused in TTHERM_00245500 !!!

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00646 ) F-box domain
  • ( PF08274 ) PhnA Zinc-Ribbon
  • ( PF08271 ) TFIIB zinc-binding
  • ( PF01414 ) Delta serrate ligand
  • ( PF02150 ) RNA polymerases M/15 Kd subunit
  • ( PF07754 ) Domain of unknown function (DUF1610)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00245500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00587.18.001983224960958e-155hypothetical protein (468 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00245500(coding)
ATGGGACATAAATCTAAGAATTTTAATCATTAAACTCCCATAAAAGATTAGATTTTTGTA
AATTAAAATTTCCATATCTTTGATCTTTAGGATAATAAAGCTGATGATAGTTACTCAAAA
AGCCTTTTGCAGCATTCTTTGATTAACTCATCAAGAGAATATATAAATTTACCAGATAGT
AAAAGTATTTAATCTCATAGAAACAGCAAAGAAAAACTTATGATTGGGAGTTCTTTGCCA
ATAAAATATTACAAATTTTAAGATCAAAAATAAGACAAAGTTCAACTCTTTTCTAAAGAT
GTGCTTGGTTCAAATTTACAAAAAAGCCCAAAAAATTAAAAAATTGAAAAGGAGCAGCAA
CAAGAAATAAAATTTTAATCTTGCTACTTGCGAAACATGATGCCTCTAAACAGCCCAGCT
ATCTTCTATAAGAGAATGAAAAACTGTAAAGTAGTTAGAGCGAATACTCCTGCTAATCTA
GAGGAAGGATCTAAAGAATTATAAAACAGGAGTAATATGCAGATACCTATTTTAGTTTTT
GACTCTTCCAATTCACAAAGTCCACAAAAGATGCAAAATGTTTATAATGAATAATAATCT
TTTAGATAGTGCCTTTACTAATAATTAGGATTTTTAAAGGAGCAAAAGGAAGATTTCTAA
GATGTTATTATAAAAAATAATGAAATTTTAGAGAGTGAAAAATAAGGAATTGAAAATCAA
GATTAGAAATACCACCAGCATTAAATATTTTAAGAAGTTTCATCACAAATATAATTTAAG
TAGCTTTAAAGTACTACTAGTGCAATTAGTACTACTGAAAAATCATAAAGAACTAAAAGT
GCAAATAATAGTTATAGAAAACAAAGAAATATCAATGATGATGGTGATTAACTATTTCAA
AATTTGTTAGTAATCAACAATTAAAAAAATAATAACAATTCAGATGATAATTAATTACAA
AACATTTAGTAATATTAAAATAAGACATTTTTTTAAGATAAGCTCATATAACAAACTAAT
TATTTAATCAATGAATAGCACAATTTTAGTTAAAAATATCAATAAGCATAATAACCTACT
TAACTCTCACCTTTTCAACATATTTAGAAATAAAAGAAAAATTAAATTTTATAAAGGATA
CAAAATACTAAAAAACTATAATAAATAAGATACAGCCCTCAGAAATATTAAATCTAAGCA
CACTCTGACTATAAAAAAGAAAAAGTAAATTCAGATAGTAAAAAGGAATAATTCCTTTCA
GAGAATAAAAATGATTAATTAAATTCTATAAGTAATGAAAATAAGACAGATATTAATAGC
TCCTTTTAAAATTCATATTATAAAAATCATCAAATTTAAGTTTAACAAGAATAAAAAGAG
AGTTAAGAAGAGATAAAATTAAATCTTAATAAAATTAAAAATGAATTGACTTCTTCTTCA
TCTGAAGAAGAGGAAATATCTCCTTTAAATGTACTGAATTAAAGGCATTTATTGACTCCA
AAATCTGTTTAAAAGAATAATCAAATTCAGTTATTTAAATAAAAATAAGATAATATATTA
ATCTACCTTGAAGATATTAGAAAGCAGCAAGATTAGCAGCTGCAATTAATAGAATAATCT
TTAACTGAAAGAAAGAATGAAAATATCAATAAAAGTAACTAGATATTAAATTTTAATTCT
TTTTTAAATTTAAGTGAGTCACATGTCCAACAAATAAACTCTGATAAAATCAAAAATAAT
CTATAAAATCATTACATGCTTCAAGAATAGAACTTAAATGAGTAAAAAAATAGTTCTACA
ACTGATTAAATTAATAAAAATATTAGAAAAAACTCTCTTTTAAGTTTCTTTCGTGGTTAA
ATTAGTTAGACAACTCCACAGAGAAATAAAGGATCTGCTTTAAACTAATATGAAAATTTA
AATGAAAACATGTTTAAATCTAATTATTATGAATTTGTAGAATAATGTGATTTAAAAAAC
TAGTTTTAAAACATATAGAATAGCATTTACATATTAAAAAATGAAGAATTTGATGGCAAT
ACCTCAAAAGTAAATACTATTCATTCAAATGGAAATAACGATTACAGCCATAGCTTGACT
AGAAAGTATGATACATAATTTGAAAGATAAATAGTGAGACAATAAAAAACTAATCAAAAA
ATATAAAGGATAGAAGCTTCAAATTAAAGTAGCATCGAAAAACTAGATACAAGAATTTAT
TTTTCTTCTACAGCTAATAGCCCTACAAGAGCTAAAAATTAGTCTGCTTTATCTCAGTTA
GAATGTATTAAAGATGAGCCTAAGCGCAGTAGAATTATACATTCTTCGTATGATAAAAGT
AGAAGTGATGTTGTCTCTTAAAAGGTTTGTAATGAAGTAGAAAAGAATATTGCAAACATC
AAGAGCAGAATAAATAGGATAAACCCTTTTTTGATAGCAAAAGCAAAAGAAGAAATACCA
GGATTTATATCTGAGTTAAAATAAAAAGAATTTGACATGGAAAATATTTAAGGATTATAG
ACAGAGAGAAAAGATAGAATGTACTCTGCTAGATTGAGGAGTGCAAATTAGAAGAAATAA
TCTTCCTCTGATATGAAAAGCAAGTAATAAACAAAAGAAACAGGCAAGAATTGTATAGTT
GTAATTAAAGATAGATAATCCTACTACAATTAAAAATCAGCAAGTACTTGCAGCTCACCA
TCTTAGAAGTATGTGTGGAATAAATTAGTAGAAAGTAAACCTGTTGAGATGAATTTAGAG
CTGTGGAATATGATAACACGATTCCTGAGTGTTGCTGACTTAAGCTTTACAAGACAAGTA
AGTAAATCGTGGAATAAATATGCCTTAAATGTGATTTAAGAGAGACACAGAAATTAATTA
TTGATAGATACTTAAAAGTCTGAAGAAATAAAGAAAAAATATGATATTTAAATGATATAC
AAAGTATTAAATTCAAAAACATAAGATATTTATTAATTATTTGGACCAATGTGTAGTTTT
TCGATACAATAGTTGTAGCAGCCTTTGTTTTTAAGTTTTCAGCCTCCTTGCTTAAAAATA
ACTCTTGAGTGTTTCCGCCTCTTTCTTTATCAAAACAAAATATATACTTTTAACAACATT
TTATTTCAATAAAAATAAAAGAAAATCAATCATCATAATTTAAGTGGAGAATCATTAGGC
TTACAAAACATGATAAATTAAATAGAAAAAAAAAGCAATAGAATTAATGACAACACATGT
AGCAACTATTCAGGTAAAATATTTAATAGCAGTAACTCTGGTTTACTCAATACAAATATA
GCAACAAATGCTATACAAGTATATGAAGACAATTCAAGAATGCAAGCTATGAGAAAAAGG
TATTATAGCAAATTATTTCTGGGAGAAAACATGAATAAGCTAAGTATCTTGCATGATGCA
GTGAATTAAAAAAAAGATTTACTTTGGTTTATTTGCACTTTTGATTACAATTAATTTGAA
AAAATTTAAAGATTATTAAAACAAAATTCAAAAATAATGTATTCAAAACAAATTTTAACT
TAGTATGGAGAAGTTGTTTTTAAAATCACAGATCTTTTATTAGGAATTGTAGCATTGTAT
AAAAAGCTATAATAGCATTATCCTCACATTATTTAATATGTAGATTCAATAAGATATTAT
TACACTATTCATTATTAGATAGGAGATAAGATAAATAAATAGATTTGA


>TTHERM_00245500(protein)
MGHKSKNFNHQTPIKDQIFVNQNFHIFDLQDNKADDSYSKSLLQHSLINSSREYINLPDS
KSIQSHRNSKEKLMIGSSLPIKYYKFQDQKQDKVQLFSKDVLGSNLQKSPKNQKIEKEQQ
QEIKFQSCYLRNMMPLNSPAIFYKRMKNCKVVRANTPANLEEGSKELQNRSNMQIPILVF
DSSNSQSPQKMQNVYNEQQSFRQCLYQQLGFLKEQKEDFQDVIIKNNEILESEKQGIENQ
DQKYHQHQIFQEVSSQIQFKQLQSTTSAISTTEKSQRTKSANNSYRKQRNINDDGDQLFQ
NLLVINNQKNNNNSDDNQLQNIQQYQNKTFFQDKLIQQTNYLINEQHNFSQKYQQAQQPT
QLSPFQHIQKQKKNQILQRIQNTKKLQQIRYSPQKYQIQAHSDYKKEKVNSDSKKEQFLS
ENKNDQLNSISNENKTDINSSFQNSYYKNHQIQVQQEQKESQEEIKLNLNKIKNELTSSS
SEEEEISPLNVLNQRHLLTPKSVQKNNQIQLFKQKQDNILIYLEDIRKQQDQQLQLIEQS
LTERKNENINKSNQILNFNSFLNLSESHVQQINSDKIKNNLQNHYMLQEQNLNEQKNSST
TDQINKNIRKNSLLSFFRGQISQTTPQRNKGSALNQYENLNENMFKSNYYEFVEQCDLKN
QFQNIQNSIYILKNEEFDGNTSKVNTIHSNGNNDYSHSLTRKYDTQFERQIVRQQKTNQK
IQRIEASNQSSIEKLDTRIYFSSTANSPTRAKNQSALSQLECIKDEPKRSRIIHSSYDKS
RSDVVSQKVCNEVEKNIANIKSRINRINPFLIAKAKEEIPGFISELKQKEFDMENIQGLQ
TERKDRMYSARLRSANQKKQSSSDMKSKQQTKETGKNCIVVIKDRQSYYNQKSASTCSSP
SQKYVWNKLVESKPVEMNLELWNMITRFLSVADLSFTRQVSKSWNKYALNVIQERHRNQL
LIDTQKSEEIKKKYDIQMIYKVLNSKTQDIYQLFGPMCSFSIQQLQQPLFLSFQPPCLKI
TLECFRLFLYQNKIYTFNNILFQQKQKKINHHNLSGESLGLQNMINQIEKKSNRINDNTC
SNYSGKIFNSSNSGLLNTNIATNAIQVYEDNSRMQAMRKRYYSKLFLGENMNKLSILHDA
VNQKKDLLWFICTFDYNQFEKIQRLLKQNSKIMYSKQILTQYGEVVFKITDLLLGIVALY
KKLQQHYPHIIQYVDSIRYYYTIHYQIGDKINKQI


>TTHERM_00245500(gene)
ATGGGACATAAATCTAAGAATTTTAATCATTAAACTCCCATAAAAGATTAGATTTTTGTA
AATTAAAATTTCCATATCTTTGATCTTTAGGATAATAAAGCTGATGATAGTTACTCAAAA
AGCCTTTTGCAGCATTCTTTGATTAACTCATCAAGAGAATATATAAATTTACCAGATAGT
AAAAGTATTTAATCTCATAGAAACAGCAAAGAAAAACTTATGATTGGGAGTTCTTTGCCA
ATAAAATATTACAAATTTTAAGATCAAAAATAAGACAAAGTTCAACTCTTTTCTAAAGAT
GTGCTTGGTTCAAATTTACAAAAAAGCCCAAAAAATTAAAAAATTGAAAAGGAGCAGCAA
CAAGAAATAAAATTTTAATCTTGCTACTTGCGAAACATGATGCCTCTAAACAGCCCAGCT
ATCTTCTATAAGAGAATGAAAAACTGTAAAGTAGTTAGAGCGAATACTCCTGCTAATCTA
GAGGAAGGATCTAAAGAATTATAAAACAGGAGTAATATGCAGATACCTATTTTAGTTTTT
GACTCTTCCAATTCACAAAGTCCACAAAAGATGCAAAATGTTTATAATGAATAATAATCT
TTTAGATAGTGCCTTTACTAATAATTAGGATTTTTAAAGGAGCAAAAGGAAGATTTCTAA
GATGTTATTATAAAAAATAATGAAATTTTAGAGAGTGAAAAATAAGGAATTGAAAATCAA
GATTAGAAATACCACCAGCATTAAATATTTTAAGAAGTTTCATCACAAATATAATTTAAG
TAGCTTTAAAGTACTACTAGTGCAATTAGTACTACTGAAAAATCATAAAGAACTAAAAGT
GCAAATAATAGTTATAGAAAACAAAGAAATATCAATGATGATGGTGATTAACTATTTCAA
AATTTGTTAGTAATCAACAATTAAAAAAATAATAACAATTCAGATGATAATTAATTACAA
AACATTTAGTAATATTAAAATAAGACATTTTTTTAAGATAAGCTCATATAACAAACTAAT
TATTTAATCAATGAATAGCACAATTTTAGTTAAAAATATCAATAAGCATAATAACCTACT
TAACTCTCACCTTTTCAACATATTTAGAAATAAAAGAAAAATTAAATTTTATAAAGGATA
CAAAATACTAAAAAACTATAATAAATAAGATACAGCCCTCAGAAATATTAAATCTAAGCA
CACTCTGACTATAAAAAAGAAAAAGTAAATTCAGATAGTAAAAAGGAATAATTCCTTTCA
GAGAATAAAAATGATTAATTAAATTCTATAAGTAATGAAAATAAGACAGATATTAATAGC
TCCTTTTAAAATTCATATTATAAAAATCATCAAATTTAAGTTTAACAAGAATAAAAAGAG
AGTTAAGAAGAGATAAAATTAAATCTTAATAAAATTAAAAATGAATTGACTTCTTCTTCA
TCTGAAGAAGAGGAAATATCTCCTTTAAATGTACTGAATTAAAGGCATTTATTGACTCCA
AAATCTGTTTAAAAGAATAATCAAATTCAGTTATTTAAATAAAAATAAGATAATATATTA
ATCTACCTTGAAGATATTAGAAAGCAGCAAGATTAGCAGCTGCAATTAATAGAATAATCT
TTAACTGAAAGAAAGAATGAAAATATCAATAAAAGTAACTAGATATTAAATTTTAATTCT
TTTTTAAATTTAAGTGAGTCACATGTCCAACAAATAAACTCTGATAAAATCAAAAATAAT
CTATAAAATCATTACATGCTTCAAGAATAGAACTTAAATGAGTAAAAAAATAGTTCTACA
ACTGATTAAATTAATAAAAATATTAGAAAAAACTCTCTTTTAAGTTTCTTTCGTGGTTAA
ATTAGTTAGACAACTCCACAGAGAAATAAAGGATCTGCTTTAAACTAATATGAAAATTTA
AATGAAAACATGTTTAAATCTAATTATTATGAATTTGTAGAATAATGTGATTTAAAAAAC
TAGTTTTAAAACATATAGAATAGCATTTACATATTAAAAAATGAAGAATTTGATGGCAAT
ACCTCAAAAGTAAATACTATTCATTCAAATGGAAATAACGATTACAGCCATAGCTTGACT
AGAAAGTATGATACATAATTTGAAAGATAAATAGTGAGACAATAAAAAACTAATCAAAAA
ATATAAAGGATAGAAGCTTCAAATTAAAGTAGCATCGAAAAACTAGATACAAGAATTTAT
TTTTCTTCTACAGCTAATAGCCCTACAAGAGCTAAAAATTAGTCTGCTTTATCTCAGTTA
GAATGTATTAAAGATGAGCCTAAGCGCAGTAGAATTATACATTCTTCGTATGATAAAAGT
AGAAGTGATGTTGTCTCTTAAAAGGTTTGTAATGAAGTAGAAAAGAATATTGCAAACATC
AAGAGCAGAATAAATAGGATAAACCCTTTTTTGATAGCAAAAGCAAAAGAAGAAATACCA
GGATTTATATCTGAGTTAAAATAAAAAGAATTTGACATGGAAAATATTTAAGGATTATAG
ACAGAGAGAAAAGATAGAATGTACTCTGCTAGATTGAGGAGTGCAAATTAGAAGAAATAA
TCTTCCTCTGATATGAAAAGCAAGTAATAAACAAAAGAAACAGGCAAGAATTGTATAGTT
GTAATTAAAGATAGATAATCCTACTACAATTAAAAATCAGCAAGTACTTGCAGCTCACCA
TCTTAGAAGTATGTGTGGAATAAATTAGTAGAAAGTAAACCTGTTGAGATGAATTTAGAG
CTGTGGAATATGATAACACGATTCCTGAGTGTTGCTGACTTAAGCTTTACAAGACAAGTA
AGTAAATCGTGGAATAAATATGCCTTAAATGTGATTTAAGAGAGACACAGAAATTAATTA
TTGATAGATACTTAAAAGTCTGAAGAAATAAAGAAAAAATATGATATTTAAATGATATAC
AAAGTATTAAATTCAAAAACATAAGATATTTATTAATTATTTGGACCAATGTGTAGTTTT
TCGATACAATAGTTGTAGCAGCCTTTGTTTTTAAGTTTTCAGCCTCCTTGCTTAAAAATA
ACTCTTGAGTGTTTCCGCCTCTTTCTTTATCAAAACAAAATATATACTTTTAACAACATT
TTATTTCAATAAAAATAAAAGAAAATCAATCATCATAATTTAAGTGGAGAATCATTAGGC
TTACAAAACATGATAAATTAAATAGAAAAAAAAAGCAATAGAATTAATGACAACACATGT
AGCAACTATTCAGGTAAAATATTTAATAGCAGTAACTCTGGTTTACTCAATACAAATATA
GCAACAAATGCTATACAAGTATATGAAGACAATTCAAGAATGCAAGCTATGAGAAAAAGG
TATTATAGCAAATTATTTCTGGGAGAAAACATGAATAAGCTAAGTATCTTGCATGATGCA
GTGAATTAAAAAAAAGATTTACTTTGGTTTATTTGCACTTTTGATTACAATTAATTTGAA
AAAATTTAAAGATTATTAAAACAAAATTCAAAAATAATGTATTCAAAACAAATTTTAACT
TAGTATGGAGAAGTTGTTTTTAAAATCACAGATCTTTTATTAGGAATTGTAGCATTGTAT
AAAAAGCTATAATAGCATTATCCTCACATTATTTAATATGTAGATTCAATAAGATATTAT
TACACTATTCATTATTAGATAGGAGATAAGATAAATAAATAGATTTGA