Identifiers and Description

Gene Model Identifier

TTHERM_00475220

Standard Name

RPB82 (RNA polymerases I, II,and III RNA common subunit RPB8B)

Aliases

PreTt02321 | 57.m00260 | 3709.m00120 | RPB8B

Description

RNA polymerase subunit ABC14.5, common to RNA polymerases I, II,and III

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00475220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13198.11.000371485572848e-69RNA polymerase Rpb8 family pro
tein (137 aa)
OxytrichaContig19419.0.g460.00000000000007997998332353294RNA polymerase Rpb8
WormBaseWBGene000178300.000000030002053728821195locus:rpb-8 Probable DNA-dir
ected RNA polymerases I, II, a
nd III subunit RPABC3 status
:Confirmed UniProt:Q19826
protein_id:CCD65759.1
DictyBaseDDB_G02780390.00000019998969434520019rpb8 on chromosome: 3 position
186227 to 187053
SGDYOR224C0.000004000864880866421RPB8 RNA polymerase subunit AB
C14.5, common to RNA polymeras
es I, II, and III

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00475220(coding)
ATGACAGATTTTACTAGCGATGCTATTTTAGTTGATGATACTTTCATAGCATCAAATATA
ATAAAAGAACCTAAATATGTTAGAACTTGGAGAGTAATTTTGAATAATGAAACATTATCA
ATCGAGATAGATATCAATTTTGATCTCTTCCCTATGGAACAAGACAAAAAATATTAGGTT
ATTCTCACTCAATCATTTTTACCAGAGTATAAAAAGAGCTTTTCTTATGCCATGTATGGA
AAGATATTTAAAATTGATTTAGAATAAGATTAATATTAAAGCATATATATTTCTTATGGA
GGTCTTGTTATGAAAATGAGAGGTAAATTAAATGATATGAGCTAAAGCATAAAAAATGAA
ACTCGTTGCTATATTTTACTAAGATAAATTTGA


>TTHERM_00475220(protein)
MTDFTSDAILVDDTFIASNIIKEPKYVRTWRVILNNETLSIEIDINFDLFPMEQDKKYQV
ILTQSFLPEYKKSFSYAMYGKIFKIDLEQDQYQSIYISYGGLVMKMRGKLNDMSQSIKNE
TRCYILLRQI


>TTHERM_00475220(gene)
ATGACAGATTTTACTAGCGATGCTATTTTAGTTGATGATACTTTCATAGCATCAAATATA
ATAAAAGAACCTAAATATGTTAGAACTTGGAGAGTAATTTTGAATAATGAAACATTATCA
ATCGAGATAGATATCAATTTTGATCTCTTCCCTATGGAACAAGACAAAAAATATTAGGTT
ATTCTCACTCAATCATTTTTACCAGAGTATAAAAAGAGCTTTTCTTATGCCATGTATGGA
AAGATATTTAAAATTGATTTAGAATAAGATTAATATTAAAGCATATATATTTCTTATGGA
GGTCTTGTTATGAAAATGAGAGGTAAATTAAATGATATGAGCTAAAGCATAAAAAATGAA
ACTCGTTGCTATATTTTACTAAGATAAATTTGA