Identifiers and Description

Gene Model Identifier

TTHERM_00549610

Standard Name

RPB81 (RNA polymerase II subunit 8A)

Aliases

PreTt15102 | 71.m00229 | 3729.m00105 | RPB8A

Description

Subunit shared in RNA polymerases I, II & III

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00549610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17079.14.0007753645635287e-88RNA polymerase Rpb8 family pro
tein (145 aa)
DictyBaseDDB_G02780396.001696815660978e-24rpb8 on chromosome: 3 position
186227 to 187053
OxytrichaContig19419.0.g463.999970367130025e-21RNA polymerase Rpb8
WormBaseWBGene000178300.000000000000001999258566166494locus:rpb-8 Probable DNA-dir
ected RNA polymerases I, II, a
nd III subunit RPABC3 status
:Confirmed UniProt:Q19826
protein_id:CCD65759.1
SGDYOR224C0.000000000003998907168546896RPB8 RNA polymerase subunit AB
C14.5, common to RNA polymeras
es I, II, and III

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00549610(coding)
ATGAGTAAAAGTGATATCTTGCTTGAAGATCGTTTCAAATTAGAAGAAATCAAGAAAGAA
GAAAAGTTTTCTAAAGTAGAAAGAGTAGTTTTAGTCAGCGATAATAACATTAAGATTGAA
ATCGATATTCATACTGATCTCTACTCAATGAAGAAGGGAAATCAATATTGGGTTATGATC
ACCTCCTCTTTAGGTAACTTCTAAGAAGACAAAGGTATTTTTGTCTCAGAAGAATTCGAC
AGAGAAAGCATCAAGGATAAGTTCGAATACGTTATGCATGGCAAAATATACAATATGAAT
TCTGACAACAAAGCTAAGACTGTGTCTATTTTTGCTAGTTTTGGTGGTTTGCTTATGAAG
GTCAGTGGTAAAGATGAAGATCTTAAAAACTTCAACGTTGATTCTAGAATTTATATTTTG
ATAAGACTTTCTTGA


>TTHERM_00549610(protein)
MSKSDILLEDRFKLEEIKKEEKFSKVERVVLVSDNNIKIEIDIHTDLYSMKKGNQYWVMI
TSSLGNFQEDKGIFVSEEFDRESIKDKFEYVMHGKIYNMNSDNKAKTVSIFASFGGLLMK
VSGKDEDLKNFNVDSRIYILIRLS


>TTHERM_00549610(gene)
ATGAGTAAAAGTGATATCTTGCTTGAAGATCGTTTCAAATTAGAAGAAATCAAGAAAGAA
GAAAAGTTTTCTAAAGTAGAAAGAGTAGTTTTAGTCAGCGATAATAACATTAAGATTGAA
ATCGATATTCATACTGATCTCTACTCAATGAAGAAGGGAAATCAATATTGGGTTATGATC
ACCTCCTCTTTAGGTAACTTCTAAGAAGACAAAGGTATTTTTGTCTCAGAAGAATTCGAC
AGAGAAAGCATCAAGGATAAGTTCGAATACGTTATGCATGGCAAAATATACAATATGAAT
TCTGACAACAAAGCTAAGACTGTGTCTATTTTTGCTAGTTTTGGTGGTTTGCTTATGAAG
GTCAGTGGTAAAGATGAAGATCTTAAAAACTTCAACGTTGATTCTAGAATTTATATTTTG
ATAAGACTTTCTTGA