Identifiers and Description

Gene Model Identifier

TTHERM_00446180

Standard Name

RPB7 (RNA polymerase II subunit 7)

Aliases

PreTt03885 | 51.m00251 | 3704.m00106

Description

RNA polymerase Rpb7, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF07650 ) KH domain
  • ( TIGR00448 ) DNA-directed RNA polymerase
  • ( PF03876 ) RNA polymerase Rpb7, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14%

TetraMine Data

TTHERM_00446180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10832.16.996525358388811e-93RNA polymerase Rpb7 domain-con
taining protein (174 aa)
DictyBaseDDB_G02848910.0000000000599805963605737rpb7 on chromosome: 4 position
2602996 to 2604032
SGDYDR404C0.0000000029989608248573072RPB7 RNA polymerase II subunit
B16; forms two subunit dissoc
iable complex with Rpb4p; invo
lved in recruitment of 3-end p
rocessing factors to transcrib
ing RNA polymerase II complex
and in export of mRNA to cytop
lasm under stress conditions;
also involved in translation i
nitiation
WormBaseWBGene000218450.000000007002490258088747locus:rpb-7 status:Partially
_confirmed UniProt:Q9N3C9
protein_id:CCD72992.1
OxytrichaContig21831.0.g920.0007999190683310628SHS2 domain found in N terminu
s of Rpb7p/Rpc25p/MJ0397

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00446180(coding)
ATGTTTTATCATACATCTGGTTTAAGAACTATTTTGTAGATTCACCCTACTCATATGGGT
ATGCTTATTGGAAATGATAAAGTCAACCTTAATAATAATGATTTGCTTAAAAAAGAATTA
ATTGAAAAAGTAGAAGGTAAAAAAAGTAATGAACATGGATATATTATTTTGGTAGTAAAT
TTAAGATATATGAGCAAACCATTAATTGATTATGATGGCTTTATTAAAGTTGAGATATAG
TTTGATGCATTAACATTTAAACCATAACTTAAAGAATATATTGATATCTAAATAACTGAA
ATCAAGCAAAATCACATTGCTGGTTCTGTTGGCCCTATGAACATATTTTATGTCCCCAAT
CGTAAGCTTCCTTAACAACTTTAAAACGAATTAAAAGATGGTAAACTTGAATCTGATGAT
TTAACCTTATACGAAGGTGATAAATTGAGAGTTTTGATAGAAACTATTAACAATGATAAA
ATCCTTTGTAAAGTAGATGATGATTTTAATAGTTATTAATGA


>TTHERM_00446180(protein)
MFYHTSGLRTILQIHPTHMGMLIGNDKVNLNNNDLLKKELIEKVEGKKSNEHGYIILVVN
LRYMSKPLIDYDGFIKVEIQFDALTFKPQLKEYIDIQITEIKQNHIAGSVGPMNIFYVPN
RKLPQQLQNELKDGKLESDDLTLYEGDKLRVLIETINNDKILCKVDDDFNSYQ


>TTHERM_00446180(gene)
ATGTTTTATCATACATCTGGTTTAAGAACTATTTTGTAGATTCACCCTACTCATATGGGT
ATGCTTATTGGAAATGATAAAGTCAACCTTAATAATAATGATTTGCTTAAAAAAGAATTA
ATTGAAAAAGTAGAAGGTAAAAAAAGTAATGAACATGGATATATTATTTTGGTAGTAAAT
TTAAGATATATGAGCAAACCATTAATTGATTATGATGGCTTTATTAAAGTTGAGATATAG
TTTGATGCATTAACATTTAAACCATAACTTAAAGAATATATTGATATCTAAATAACTGAA
ATCAAGCAAAATCACATTGCTGGTTCTGTTGGCCCTATGAACATATTTTATGTCCCCAAT
CGTAAGCTTCCTTAACAACTTTAAAAGTAATAATTTTATTTTTAATTAATTATGTTAAAT
ATTAAAAATTGGAATAGTGTATTTGTTTTTTTATATAGATCATGTTTATTAAAGATTATT
AACTTATAAATTAGCGAATTAAAAGATGGTAAACTTGAATCTGATGATTTAACCTTATAC
GAAGGTGATAAATTGAGAGTTTTGATAGAAACTATTAACAATGATAAAATCCTTTGTAAA
GTAGATGATGATTTTAATAGTTATTAATGA