Identifiers and Description

Gene Model Identifier

TTHERM_00421170

Standard Name

RPB6 (RNA polymerase II subunit 6)

Aliases

PreTt07241 | 46.m00296 | 3679.m00146

Description

Subunit shared in RNA polymerases I, II & III

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01192 ) RNA polymerases K / 14

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00421170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10954.12.9996910481190226e-100RNA polymerase K/14 to 18 kDa
subunit protein (164 aa)
OxytrichaContig8949.0.g1069.997975313387782e-28RNA polymerase Rpb6
SGDYPR187W2.000130478826482e-26RPO26 RNA polymerase subunit A
BC23, common to RNA polymerase
s I, II, and III; part of cent
ral core; similar to bacterial
omega subunit
WormBaseWBGene000073559.996273942859018e-26locus:rpb-6 Probable DNA-dir
ected RNA polymerases I, II, a
nd III subunit RPABC2 status
:Confirmed UniProt:Q17684
protein_id:CAA90053.1
DictyBaseDDB_G02910373.001290106883431e-24rpb6 on chromosome: 5 position
4838044 to 4838564
Stentor CoeruleusSteCoe_172830.00000000000003442477108469977

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00421170(coding)
ATGAGCGACTACGGTGATAACGATTACTCTGATCCTGGTAATTTTGATGAGGATAATATG
GGAGATGACATGGATGATGGAGATCAAGAATCTGAAGAAGCCTCTTCCAGATCCGGAGAT
GAGGGTGATTCAGCTGATGATTCTGATCACTCTGGAACTGAATCTGAAAGTTAATCTGAA
GTCGATAAGGACGAATATCCTGAAGAAATGGTTATCATAAAAGATTAAGATAGAGATTAA
TAAGCAAGTAAAACCAAAGTAACACCTCCTTTCCTCACAAAATATGAAAAAGCCAGAATT
ATTGGAACACGCGCCTTATAAATTGCTCAAAACTCTCCAATCTATGTAGAAACAGATGAC
AAGGACTATGATCCTATTGCTATTGCCGAAAAAGAGTTTGTCTAGAAAAAGATCCCCTTT
ATTATTAGAAGATATCTTCCCAATAAAGAATATGAAGATTGGGCTCTCGATGAATTAGAA
GTCTTAGATTGA


>TTHERM_00421170(protein)
MSDYGDNDYSDPGNFDEDNMGDDMDDGDQESEEASSRSGDEGDSADDSDHSGTESESQSE
VDKDEYPEEMVIIKDQDRDQQASKTKVTPPFLTKYEKARIIGTRALQIAQNSPIYVETDD
KDYDPIAIAEKEFVQKKIPFIIRRYLPNKEYEDWALDELEVLD


>TTHERM_00421170(gene)
ATGAGCGACTACGGTGATAACGATTACTCTGATCCTGGTAATTTTGATGAGGATAATATG
GGAGATGACATGGATGATGGAGATCAAGAATCTGAAGAAGCCTCTTCCAGATCCGGAGAT
GAGGGTGATTCAGCTGATGATTCTGATCACTCTGGAACTGAATCTGAAAGTTAATCTGAA
GTCGATAAGGACGAATATCCTGAAGAAATGGTTATCATAAAAGATTAAGATAGAGATTAA
TAAGCAAGTAAAACCAAAGTAACACCTCCTTTCCTCACAAAATATGAAAAAGCCAGAATT
ATTGGAACACGCGCCTTATAAATTGCTCAAAACTCTCCAATCTATGTAGAAACAGATGAC
AGTAATATAAAAATTATTTTTTTTTAAGCTTGACAGAAATAGATTACCGAAATTAGAAAA
CAAGAATATTTAGAATACCAAACTGCAATTTAATGAAAATAGCTAAGTATTTTCCTTATT
TCGATAGCATAAATAACAATTTAAGTATTTATTTGCAAGAGATAGCAAAATAATTTAAAT
TTATGGAACAAATATGAAAATGATGAAAATAAATAATAAAAAAAAACAAAATTTTTTAAA
AGGAATGAACAAAGATAGTTTTATTTCAAGCAAAAATTTGATTTTAATTTGAATATAAAT
AAAATAATTTATTTATTTTAAATAAAACAGAGGACTATGATCCTATTGCTATTGCCGAAA
AAGAGTTTGTCTAGAAAAAGATCCCCTTTATTATTAGAAGATATCTTCCCAATAAAGAAT
ATGAAGATTGGGCTCTCGATGAATTAGAAGTCTTAGATTGA