Identifiers and Description

Gene Model Identifier

TTHERM_00941450

Standard Name

RPB5 (RNA polymerase II subunit 5)

Aliases

PreTt25151 | 171.m00060

Description

Subunit shared in RNA polymerases I, II & III

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01191 ) RNA polymerase Rpb5, C-terminal domain
  • ( PF03871 ) RNA polymerase Rpb5, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.3%

TetraMine Data

TTHERM_00941450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19596.17.996706633065278e-159RNA polymerase Rpb5 domain-con
taining protein (277 aa)
WormBaseWBGene000192466.999211576891585e-27locus:rpb-5 DNA-directed RNA
polymerases I, II, and III su
bunit RPABC1 status:Confirme
d UniProt:Q9N5K2 protein_i
d:CCD72467.1
DictyBaseDDB_G02916369.998720540547892e-23rpb5 on chromosome: 6 position
457932 to 458567
OxytrichaContig486.1.g679.998720540547892e-23RNA polymerase Rpb5, C-termina
l domain
SGDYBR154C1.0002869940498747e-21RPB5 RNA polymerase subunit AB
C27, common to RNA polymerases
I, II, and III; contacts DNA
and affects transactivation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00941450(coding)
ATGAGCGAGGATTAGAGAAAGAGTGCCTAAAAGTGGTTTAAGGTTTACCGCACTATTTGC
GAAATGGCCAGAGATAGAGGATACAGCGAAGAAGCTGAGCAATAGTTGAATCTGATTAAA
ACTAAGGAATAGGAAAATATGTGGATTTAAAACAGCATGTCTAACGTTCAAAACAGTTTA
ACCATAAATTCTTTTTCACATGATGCTAACCAAACTGATGAACACAAATTTTTAGGAATG
GAATAGCACCTTTACGTTTTCCATAGCTAAACTAAGTTAACCGATGATATACTTAGCTCA
TATGATAAGACTATTTAAAAATATCACGAGTCTTCTATTAAAAACAATCCTTAATTGAAC
GTTTTTATTAATGTTGTTATTCTTGTCCCAGAAGAAAAAGATATCGTCACTAAGAAAGTT
TAAGATATCATTCTCATCTCAAACAAGTATTTTAAAGATAGAATTGAACTCTTTGAAAAG
AGATAGGTTGAAATGAACTTCAACAGTAAAAAGTAAACTGATATTAAATCTGAAACAGAT
GATAAAGGCGATGTCATTTAAATCTTCTATAAATATGAAATTTTCTTCTTTGATGATCTT
GTCATTAACATCACCAAGCATCAATTAGTTCCTAAGCACGTACCCTTGAATGCCATCGAA
AAGAAAAAATTAATGGATAAATACAAAATTAACGATGCTTAACTCCCTAAGATCCTTTCC
ACCGACCCAATTACAAAATATTTTGGATTAAGGACAAAGCAAGTTTTCAAAATAGAAAGA
GATTCTGAAACTGCTGGTAAATATATTACTTATAGAATTGTTAGTTGA


>TTHERM_00941450(protein)
MSEDQRKSAQKWFKVYRTICEMARDRGYSEEAEQQLNLIKTKEQENMWIQNSMSNVQNSL
TINSFSHDANQTDEHKFLGMEQHLYVFHSQTKLTDDILSSYDKTIQKYHESSIKNNPQLN
VFINVVILVPEEKDIVTKKVQDIILISNKYFKDRIELFEKRQVEMNFNSKKQTDIKSETD
DKGDVIQIFYKYEIFFFDDLVINITKHQLVPKHVPLNAIEKKKLMDKYKINDAQLPKILS
TDPITKYFGLRTKQVFKIERDSETAGKYITYRIVS


>TTHERM_00941450(gene)
ATGAGCGAGGATTAGAGAAAGAGTGCCTAAAAGTGGTTTAAGGTTTACCGCACTATTTGC
GAAATGGCCAGAGATAGAGGTAATCTAATTTAACTAATAAATTAAATAACTCTTAGTTCG
AAATATGCATACTTTCATTTCAAAATTTTCAGATGATCGTAGTGCACAATATTGTTAAAA
AAAGCCTTTTGTATAAAAGATAAGTGTATTAATAAGATTTTATGCAAGCGAATGATAAGC
AAAATTAATTAATTAAAATATTTTTCAGAAACAAAATAAAAAGATTAAGTTTGTTGATAA
ATAAACTGCAACTATAAAATAAATAATCTGAATTTAGCTATTTAATTGAATTTTTTATCT
TGCTAATTAAAGGATACAGCGAAGAAGCTGAGCAATAGTTGAATCTGATTAAAACTAAGG
AATAGGAAAATATGTGGATTTAAAACAGCATGTCTAACGTTCAAAACAGTTTAACCATAA
ATTCTTTTTCACATGATGCTAACCAAACTGATGAACACAAATTTTTAGGAATGGAATAGC
ACCTTTACGTTTTCCATAGCTAAACTAAGTTAACCGATGATATACTTAGCTCATATGATA
AGACTATTTAAAAATATCACGAGTCTTCTATTAAAAACAATCCTTAATTGAACGTTTTTA
TTAATGTTGTTATTCTTGTCCCAGAAGAAAAAGATATCGTCACTAAGAAAGTTTAAGATG
TACTTAAATTTTTTATTTCTAGACACATTGCTTTCTACTTGATTTTATTATATTAATAAA
TTAATAAATAAATAAATTGGATTATTAGAATTATTTTATTTTAGAATATCTTATTAAAAT
AATTTGAAAAATTTACTAAAAACATTTTTAATCAATAATAATTATAGATCATTCTCATCT
CAAACAAGTATTTTAAAGATAGAATTGAACTCTTTGAAAAGAGATAGGTTGAAATGAACT
TCAACAGTAAAAAGTAAACTGATATTAAATCTGAAACAGATGATAAAGGCGATGTCATTT
AAATCTTCTATAAATATGAAATTTTCTTCTTTGATGATCTTGTCATTAACATCACCAAGC
ATCAATTAGTTCCTAAGCACGTACCCTTGAATGCCATCGAAAAGAAAAAATTAATGGATA
AATAGTAAAAAAATATTTTTTTTATTTGTATTTCGTTTAAACAATTTTTTTAATAAAAGC
AAAATTAACGATGCTTAACTCCCTAAGATCCTTTCCACCGACCCAATTACAAAATATTTT
GGATTAAGGACAAAGCAAGTAATAAATTTAAAATAAAAAATAAATGGCAATAATATTAAT
TATTAACTATAAATTTACTAGGTTTTCAAAATAGAAAGAGATTCTGAAACTGCTGGTAAA
TATATTACTTATAGAATTGTTAGTTGA