Identifiers and Description

Gene Model Identifier

TTHERM_00313550

Standard Name

RPB4 (RNA polymerase II subunit 4)

Aliases

PreTt03542 | 30.m00351 | 3810.m01963

Description

4th largest subunit of RNA polymerase II

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00313550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
WormBaseWBGene000449240.000009002574193719714status:Confirmed UniProt:Q0G
841 protein_id:CAL36509.1
DictyBaseDDB_G02865210.000030009396760408108rpc9 on chromosome: 4 position
4587626 to 4588190
SGDYJL011C0.00010003404299092957RPC17 RNA polymerase III subun
it C17; physically interacts w
ith C31, C11, and TFIIIB70; ma
y be involved in the recruitme
nt of pol III by the preinitia
tion complex

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00313550(coding)
ATGGATGAAAAAAAGGAAACTAGAATTAAGTTAACAAATTAAGAAGCATTTTTGATAATA
CAGGAATAGGTGGAAAAGTAGAAATAAGAAAATCTTTTTTCAGCTAAAAATACTTAAATG
ACTTAAAAGCTTTTTGAGTTTCTGGACTCCTAGCCTAAATATATCATGAATTCTAATTTT
GTAAATGAGTTAAAAAATCTGTTGCTTCAATTTTCTTTAACATAAAATGAAATAATTTAA
ATTTTTAATGTTTTGCCTACAAAAGAAATAGATTTGCAACTGATAATAGAGAGCTGTGAA
ACTAAGTTAGATGAAAAAAATATTGAAGCTATTATTAAAAAGTGTGAGCAAATAAGAAAT
CAGTATTAAAAATAGCAAAACTCTAACAATTGA


>TTHERM_00313550(protein)
MDEKKETRIKLTNQEAFLIIQEQVEKQKQENLFSAKNTQMTQKLFEFLDSQPKYIMNSNF
VNELKNLLLQFSLTQNEIIQIFNVLPTKEIDLQLIIESCETKLDEKNIEAIIKKCEQIRN
QYQKQQNSNN


>TTHERM_00313550(gene)
ATGGATGAAAAAAAGTAGAAATAATTTATTTTAGACTATTTTACTTATTTATTAACTACC
TTTAAAAAGGGAAACTAGAATTAAGTTAACAAATTAAGAAGCATTTTTGATAATACAGGA
ATAGGTGGAAAAGTAGAAATAAGAAAATCTTTTTTCAGCTAAAAATACTTAAATGACTTA
AAAGGTATTCATAAATTATTTTTTACCTATTATTAGTCATTTAATTTTTATATTTTTATG
TAATTATATTTATCATTATATTTATTATAATAGCTTTTTGAGTTTCTGGACTCCTAGCCT
AAATATATCATGAATTCTAATTTTGTAAATGAGTTAAAAAATCTGTTGCTTCAATTTTCT
TTAACATAAAATGAAATAATTTAAATTTTTAATGTTTTGCCTACAAAAGAAATAGATTTG
CAACTGGTAAGTTATTTTAAATTAATGTTATAACCTATTACAAAATCTAATAAATAGATA
ATAGAGAGCTGTGAAACTAAGTTAGATGAAAAAAATATTGAAGCTATTATTAAAAAGTGT
GAGCAAATAAGAAATCAGTATTAAAAATAGCAAAACTCTAACAATTGA