Identifiers and Description

Gene Model Identifier

TTHERM_00193849

Standard Name

RPB3 (RNA Polymerase II subunit 3)

Aliases

16.m05348 | cnjC

Description

DNA-directed rna polymerase II subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00037 ) 4Fe-4S binding domain
  • ( PF01193 ) RNA polymerase Rpb3/Rpb11 dimerisation domain
  • ( PF01000 ) DNA-directed RNA polymerase, alpha subunit,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00193849

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03659.19.997093137033517e-262DNA-directed RNA polymerase II
subunit (311 aa)
DictyBaseDDB_G02922449.997863464222902e-69rpb3 on chromosome: 6 position
1368967 to 1370237
OxytrichaContig8173.0.g808.99739772315193e-58RNA polymerase Rpb3/RpoA inser
t domain
SGDYIL021W2.00017271388466e-38RPB3 RNA polymerase II third l
argest subunit B44, part of ce
ntral core; similar to prokary
otic alpha subunit
WormBaseWBGene000079713.9997566980151843e-38locus:rpb-3 status:Partially
_confirmed UniProt:Q93338
protein_id:CAB02268.2
Stentor CoeruleusSteCoe_223573.975449735908647e-31

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15470252: Mochizuki K, Gorovsky MA (2004) RNA polymerase II localizes in Tetrahymena thermophila meiotic micronuclei when micronuclear transcription associated with genome rearrangement occurs. Eukaryotic cell 3(5):1233-40
  2. Ref:10704239: Larsen LK, Andreasen PH, Dreisig H, Palm L, Nielsen H, Engberg J, Kristiansen K (1999) Cloning and characterization of the gene encoding the highly expressed ribosomal protein l3 of the ciliated protozoan Tetrahymena thermophila. Evidence for differential codon usage in highly expressed genes. Cell biology international 23(8):551-60
  3. Ref:2112240: Martindale DW (1990) A conjugation-specific gene (cnjC) from Tetrahymena encodes a protein homologous to yeast RNA polymerase subunits (RPB3, RPC40) and similar to a portion of the prokaryotic RNA polymerase alpha subunit (rpoA). Nucleic acids research 18(10):2953-60

Sequences

>TTHERM_00193849(protein)
MEGIKLTLTNLEEFKCEFTLENCDISLANSLRRILLAEIETIAIHNVKVYENTSSLPDEY
IAHRLGLIPLNSAKVDDYNYIWNCNCQGECDRCTIHFDLRVSNFTNEVLEVTSLDLKQRQ
DHTDEDAVRPIKVYSILRDEYGNKREVGIPIIKLSKGQQIHFECEAQKGIGKMHSKWNPV
CISTFSVEPEIIFDQEIQNLDIEQKKALVNACPTKVFGINPHTNTLEVQDHMKCMYCEEC
VYKCAEDFQKPKLIKIDHKKDKFFFKVETTGVMKPVEVLRRGFSTLRQKLDFMREQIQEN
SNNQFEYGNE


>TTHERM_00193849(coding)
ATGGAAGGAATTAAATTAACTCTTACAAACCTCGAAGAATTCAAATGCGAATTTACCCTA
GAAAATTGCGATATCTCATTAGCTAATTCATTAAGAAGAATTCTTTTGGCTGAAATTGAA
ACAATAGCTATCCATAACGTTAAAGTATATGAGAATACATCTTCTCTTCCTGATGAATAC
ATAGCACATAGATTAGGTTTAATTCCTTTAAATTCTGCTAAAGTTGATGATTATAACTAT
ATTTGGAATTGCAATTGCCAAGGTGAATGCGATAGATGTACAATTCATTTTGATTTGAGA
GTGAGTAACTTTACAAATGAAGTCTTAGAAGTTACTTCTCTTGATCTTAAATAAAGATAG
GACCACACTGATGAAGATGCCGTTCGCCCTATAAAGGTATATTCAATTTTACGTGATGAA
TATGGAAATAAGAGAGAAGTAGGTATTCCTATTATCAAGCTATCTAAAGGACAATAAATT
CACTTTGAATGTGAAGCCTAGAAAGGTATCGGTAAAATGCATTCTAAATGGAATCCAGTA
TGTATTTCAACTTTCTCAGTTGAACCTGAAATTATTTTCGATCAAGAAATTTAAAATTTA
GATATTGAATAGAAGAAAGCTCTAGTAAATGCATGTCCTACTAAAGTATTTGGTATCAAT
CCTCATACCAATACTTTGGAAGTCTAAGATCACATGAAATGTATGTATTGTGAAGAATGT
GTTTACAAGTGTGCTGAAGACTTCTAAAAACCTAAATTAATCAAAATAGACCATAAAAAG
GATAAGTTTTTCTTCAAAGTCGAAACTACAGGAGTTATGAAGCCTGTTGAAGTGTTAAGA
AGAGGTTTTTCAACCTTGAGATAGAAGCTTGATTTTATGAGAGAATAAATCTAAGAAAAT
TCTAATAATTAATTTGAATATGGTAACGAGTGA


>TTHERM_00193849(gene)
ATGGAAGGAATTAAATTAACTCTTACAAACCTCGAAGAATTCAAATGCGAATTTACCCTA
GAAAATTGCGATATCTCATTAGCTAATTCATTAAGAAGAATTCTTTTGGCTGAAATTGAA
ACAATAGCTATCCATAACGTTAAAGTATATGAGAATACATCTTCTCTTCCTGATGAATAC
ATAGCACATAGATTAGGTTTAATTCCTTTAAATTCTGCTAAAGTTGATGATTATAACTAT
ATTTGGAATTGCAATTGCCAAGGTGAATGCGATAGATGTACAATTCATTTTGATTTGAGA
GTGAGTAACTTTACAAATGAAGTCTTAGAAGTTACTTCTCTTGATCTTAAATAAAGATAG
GACCACACTGATGAAGATGCCGTTCGCCCTATAAAGGTATATTCAATTTTACGTGATGAA
TATGGAAATAAGAGAGAAGTAGGTATTCCTATTATCAAGCTATCTAAAGGACAATAAATT
CACTTTGAATGTGAAGCCTAGAAAGGTATCGGTAAAATGCATTCTAAATGGAATCCAGTA
TGTATTTCAACTTTCTCAGTTGAACCTGAAATTATTTTCGATCAAGAAATTTAAAATTTA
GATATTGAATAGAAGAAAGCTCTAGTAAATGCATGTCCTACTAAAGTATTTGGTATCAAT
CCTCATACCAATACTTTGGAAGTCTAAGATCACATGAAATGTATGTATTGTGAAGAATGT
GTTTACAAGTGTGCTGAAGACTTCTAAAAACCTAAATTAATCAAAATAGACCATAAAAAG
GATAAGTTTTTCTTCAAAGTCGAAACTACAGGAGTTATGAAGCCTGTTGAAGTGTTAAGA
AGAGGTTTTTCAACCTTGAGATAGAAGCTTGATTTTATGAGAGAATAAATCTAAGAAAAT
TCTAATAATTAATTTGAATATGGTAACGAGTGA