Identifiers and Description

Gene Model Identifier

TTHERM_00077230

Standard Name

RPB2 (RNA Polymerase B )

Aliases

PreTt10069 | 5.m00420 | 3828.m01330

Description

RNA polymerase II subunit 2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF06828 ) Fukutin-related
  • ( PF04560 ) RNA polymerase Rpb2, domain 7
  • ( PF04561 ) RNA polymerase Rpb2, domain 2
  • ( PF04565 ) RNA polymerase Rpb2, domain 3
  • ( PF04566 ) RNA polymerase Rpb2, domain 4
  • ( PF04567 ) RNA polymerase Rpb2, domain 5
  • ( PF00562 ) DNA-directed RNA polymerase, beta subunit
  • ( PF04563 ) DNA-directed RNA polymerase, beta subunit
  • ( TIGR02013 ) DNA-directed RNA polymerase, beta subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00077230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_226750
WormBaseWBGene000161409.997093137033517e-262locus:rpb-2 DNA-directed RNA
polymerase II subunit RPB2
status:Confirmed UniProt:Q10
578 protein_id:CCD65728.1
Tetrahymena borealisEI9_07105.19.997093137033517e-262DNA-directed RNA polymerase, b
eta subunit protein (1236 aa)
DictyBaseDDB_G02882579.997093137033517e-262rpb2 on chromosome: 5 position
1296275 to 1300079
OxytrichaContig1141.1.g19.997093137033517e-262RNA polymerase Rpb2, domain 6
SGDYOR151C9.997093137033517e-262RPB2 RNA polymerase II second
largest subunit B150, part of
central core; similar to bacte
rial beta subunit

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:8982086: Guerreiro P, Rodrigues-Pousada C (1996) Characterization of a polyubiquitin gene in T. thermophila and of ubiquitin gene expression during sexual reproduction and under stress conditions. Gene 182(1-2):183-8

Sequences

>TTHERM_00077230(coding)
ATGGACGAGGAAGAATCATTTTTCGAAGGTGAAAACAGCGCACCTGTTTATGATGATGAA
TTAAATGAAAATATAGATTAAGATGACTGTTGGAAAATTATTGATGAATATTTCAAGGAT
AATGGTCTCTGTTCTCATTAAATTAAATCTTACAATCACTTTATTGAATCTCTTCCTTTA
ATCATGGAAGACTTTAAGATTGAAGTGAGACCTACTGAAAATTATATGAATTCTAATAAA
AAGGAATAGCAAATTAGGAGCTAAACTTCATACACTTTAACATTTGACAGGCCTCGTAAA
CCTTTGCCTCCTTAAAAGTTCCATATGGAAAGAACTTTTGGATGGGGAAGAAGAGGATAG
GATGCTTAATCTTCAAGCCATGCACAAAAGATCTATCCTATGATGGCTCGTATCAGTGAT
TTGGATTATTTTGTAGAAATTAAAATTCCAGTTTAGTTAGTCAGAACCATCAAACATCCT
GATGGCACAGAACAAAAAGAGTTAATCACAAGCAGAGACAAAAACCAAAATTTAATCACA
CTTTTCAAATTACCCGTCATGGTTCAATCCATGTATTGCAGTCTTGCAGGAGAAAATCTT
GAAGGTAGAATCAAACACGGTGAATGTTAATTTGATTAAGGTGGTTATTTCATTATCAAA
GGTTCAGAAAAAGTCATCATTGCTCAAGAACGTATGGCCTTCAACTTCGTTTATGTCTTC
CAACAAAAAGATCCAAAAATGCCTTGGATAGCAGAAATCAGATCAATCAGAGACAAAACT
AATGCTGTTTAATCTAAATTTGCTTTAAAATTAAAACTTAGAGACGGAGAATATCAACTT
TATGCAAGATGCAAACTTATTAATGAAGATATCCCTATTTTCGTTTTACTTAAAGCTCTT
GGTTGTGTTGAAAGTGATAAGGAAATGATGGAACGTATATTTTATAATTTAAAGGATCCT
AAAAATGAATAAATGATGGAAATGCTTCGTTCCTCCCTCTTGCTCGCTCAACATTGTAAC
AATAAAAGAGAAGCCCTTATTTTCATCGGTTACAGAATTAATGCAACCACAAATTATAGA
GGATCTCAAGAAGCCATGCAATCAGCAGAAGATACTCTTAAGCTTTACTTACTCCCTCAT
ATTGGTACCCAAGAATCTGATAATGATAAAAAGCTTTTCTTCATTGGATATATGATTTAA
AAATTGTTAAATGCTGCTCTTGGCAAGACTCAAGAAGATGATAGAGATCACTATGGTAAA
AAGAGATTGGATATGGCTGGTGCACTTATCAGTTAGTTATTCAAGGAAAGACTTAGAATA
TTCCAAAAGAATGCAAAGAAGAATTTGCAATAAAAAATAAATGACATATCTAGAGATGCT
CAAAAATCTCTTAATGTTATTGTAGATATTTTCGATCATAAGTTGATTTCAGATCATATT
AGATTGGCTCTAGCCACTGGTAATTGGGGTTAGACAGCAGACGGAGAAGTAGTCAAAACT
GGTGTTGCTTAGGTATTAAAAAGAGATACTTCATTATTCGCAACTATGTCTCACATGAGA
AGAGTTAATGCTCCTATGAAATCAGCTGCTAAGCTTGCCAGACCTCGTTAATTGCACAAT
ACTCACTACGGTTTAATTTGCCCTGCTGAAACTCCTGAAGGTTAGAAAATTGGTATGGTT
AAAAACTTGTCTCTATTGGCTTAAGTTTCCCTAGGTCTAAGTTCTTAGGATAACTTAAAG
ATTCAAGAATAGTTAGAAGAACAAATTAACTAATTTGATATTCTTAATCTTAAGCTTGAA
AAGATTCCTTACTAAACAAAAGTGTTCTTCAATGGTAATTGGATTGGTTTTACCGAAACA
CCTGAATAAATTATTGATGTCTTTAAGGAAATTAGAAGATTGCAAAAAATCGATGGTTTT
TCTATTGTCAGAGATATTATTAACAAAGAAATCAGAATTTACACTGATCAAGGTAGAGGT
ATGAGACCAGTTTTTACTGTGTAAGAAATCTGTGAAGGAAAAAATAGACTCAAGATTACA
AAATCTAAATTATATGCTATCCTCCAGTAATTTGAAGGCAAGGCATTTTAAAAATTAATT
GATGAAGGTTTTATTGAACTTTTGGACGTCGAAGAAGAAGAAGGTGCTTTAATTGCTGTA
GATATAAATGATTTTTACCACACTGATGATCCAAGAAGAACTAATCTTCCTTTCACTCAT
TGCGAAATTCACCCTGCTATGATTCTTGGTGTCTGTGCTTCCGTTATTCCTTTTGGACAT
CACAACTAAGGTCCAAGAAATACTCTTTAATCTGCTATGGGTAAACAGGCTATGGGTTTA
AATTCAACTAATTTCCATATGAGACTTGACACTCTTTGCCATATTTTGTACTATCCTCAA
ATTGCACTTGCTTCAAGTAAATCTCTCTAATACATTACTGCTAAAGATATTCCTATTGGA
AGTAATGCAGTTGTAGCTATTGCTTGCTTTACTGGTTACAACCAAGAAGATAGTATTATC
ATTAATTAGAGTGCCATAGATAGAGGTCTCTTTAGATCTATCCTCTACAGAACTTACAAA
ACAACAGAAAAGAAAGAACATATGGGTCTTAATCCTGTCATTGAACATATTAGATTCCCC
GATGAAAAGAAAACTATCATCCCTGCAAGTTATTCGTTCCTTAAATTGGACTATGATGGA
ATCATACCACCTGGAACTTAAGTAACTGGTGAAGATGTCTTGATTGGTAAAGTTGTTGAA
TTACCAAAGACTGAAGGATCTGACAAATAATATAAGGATGTTTCTTTGGGATGCAGAAGA
TCTGAAATTGGTTATGTTGACACTGTTATTCTCTCAGAAGATAAGGATGGTATGTATATT
GTAAAGGTCAAGCTTCGTTCTAATAGAATTCCATAAATTGGTGATAAATTTGCTTCCCGT
CATGGTTAAAAAGGTACATGCGGTATGACTATTAGAGGTGAAGATTTGCCATACAACATT
GAAGGTATCATTGCTGAATTGGTTATTAATCCACATTGTATTCCCTCTCGTATGACTATT
GGTCATATGATTGAAGGTCTTAATTCAAAGCTATCTTCTTTAAAGGGTATTTGGGGTGAT
GCTACTCCATTCTCTGGCATTAAATTACAAGATATTGCCTCCGAACTTCACACTTATGGA
TATCAAAGATATGGTAATGAAGTCTTGTACAATCCTTACACAGGTATGAGACTCTCTACT
TAAATTTATTATGGTCCTACTTTCTATCAACGTCTTAGACATTTAGTCGATGATAAAATG
TATTCTCGTTCTAGAGGTCCAGTTGTAGCAATTGTCAGACAACCTACTCACGGTCGTTCC
AGAGGTGGTGGTTTACGTTTTGGTGAAATGGAAAGAGATTGTATCATTGCTCACGGTACC
AGTAATTTCTTAAAAGAAAGAACATTTGGCGTTTCTGATCAGTTCAGAACCCATGTTTGC
TCAAGATGTGGTTTGTTTGCTAAAGCAGATGTTACAAATCACAAGTATGACTGTACTGGC
TGCTCTTAAGGTGATAAGAAGCACTACAAAATCGTCCAAGTGTATCTCCCATATGCAGCT
AAGCAACTTATTCAAGAACTTATGGCTATGCATATTGTTCCAAGAATTAAAGTTGATGTC
ACTAGTAAAAAGTATGTTTGA


>TTHERM_00077230(protein)
MDEEESFFEGENSAPVYDDELNENIDQDDCWKIIDEYFKDNGLCSHQIKSYNHFIESLPL
IMEDFKIEVRPTENYMNSNKKEQQIRSQTSYTLTFDRPRKPLPPQKFHMERTFGWGRRGQ
DAQSSSHAQKIYPMMARISDLDYFVEIKIPVQLVRTIKHPDGTEQKELITSRDKNQNLIT
LFKLPVMVQSMYCSLAGENLEGRIKHGECQFDQGGYFIIKGSEKVIIAQERMAFNFVYVF
QQKDPKMPWIAEIRSIRDKTNAVQSKFALKLKLRDGEYQLYARCKLINEDIPIFVLLKAL
GCVESDKEMMERIFYNLKDPKNEQMMEMLRSSLLLAQHCNNKREALIFIGYRINATTNYR
GSQEAMQSAEDTLKLYLLPHIGTQESDNDKKLFFIGYMIQKLLNAALGKTQEDDRDHYGK
KRLDMAGALISQLFKERLRIFQKNAKKNLQQKINDISRDAQKSLNVIVDIFDHKLISDHI
RLALATGNWGQTADGEVVKTGVAQVLKRDTSLFATMSHMRRVNAPMKSAAKLARPRQLHN
THYGLICPAETPEGQKIGMVKNLSLLAQVSLGLSSQDNLKIQEQLEEQINQFDILNLKLE
KIPYQTKVFFNGNWIGFTETPEQIIDVFKEIRRLQKIDGFSIVRDIINKEIRIYTDQGRG
MRPVFTVQEICEGKNRLKITKSKLYAILQQFEGKAFQKLIDEGFIELLDVEEEEGALIAV
DINDFYHTDDPRRTNLPFTHCEIHPAMILGVCASVIPFGHHNQGPRNTLQSAMGKQAMGL
NSTNFHMRLDTLCHILYYPQIALASSKSLQYITAKDIPIGSNAVVAIACFTGYNQEDSII
INQSAIDRGLFRSILYRTYKTTEKKEHMGLNPVIEHIRFPDEKKTIIPASYSFLKLDYDG
IIPPGTQVTGEDVLIGKVVELPKTEGSDKQYKDVSLGCRRSEIGYVDTVILSEDKDGMYI
VKVKLRSNRIPQIGDKFASRHGQKGTCGMTIRGEDLPYNIEGIIAELVINPHCIPSRMTI
GHMIEGLNSKLSSLKGIWGDATPFSGIKLQDIASELHTYGYQRYGNEVLYNPYTGMRLST
QIYYGPTFYQRLRHLVDDKMYSRSRGPVVAIVRQPTHGRSRGGGLRFGEMERDCIIAHGT
SNFLKERTFGVSDQFRTHVCSRCGLFAKADVTNHKYDCTGCSQGDKKHYKIVQVYLPYAA
KQLIQELMAMHIVPRIKVDVTSKKYV


>TTHERM_00077230(gene)
ATGGACGAGGAAGAATCATTTTTCGAAGGTGAAAACAGCGCACCTGTTTATGATGATGAA
TTAAATGAAAATATAGATTAAGATGACTGTTGGAAAATTATTGATGAATATTTCAAGGAT
AATGGTCTCTGTTCTCATTAAATTAAATCTTACAATCACTTTATTGAATCTCTTCCTTTA
ATCATGGAAGACTTTAAGATTGAAGTGAGACCTACTGAAAATTATATGAATTCTAATAAA
AAGGAATAGCAAATTAGGAGCTAAACTTCATACACTTTAACATTTGACAGGCCTCGTAAA
CCTTTGCCTCCTTAAAAGTTCCATATGGAAAGAACTTTTGGATGGGGAAGAAGAGGATAG
GATGCTTAATCTTCAAGTAAAAATAATTTTATATTCTATGAAATACCTATTTAATCACTC
TCTCTAGCTAAAATTGATTGAATTATTACTATTTTAATTTTTACACCATCAAAACGTTGC
TTACTAATGAAATAAGACAATAAATTGCAGATAGATTCGAATTTTAATTTACTTAAAAAT
ATTTCTACTTGATGTTAACTTCAAACAAAATATTTTTAAAATGCAAAATGAGTTTATTTG
TTTGCTGGAGAGAAAGAGATTGACAGATTATGTTTAAAATGAATGATTTTAAAAATAAAG
AATGAAAGTGAAATAAGTTTGTTTTGTATTAAAAAATAGGCCATGCACAAAAGATCTATC
CTATGATGGCTCGTATCAGTGATTTGGATTATTTTGTAGAAATTAAAATTCCAGTTTAGT
TAGTCAGAACCATCAAACATCCTGATGGCACAGAACAAAAAGAGTTAATCACAAGCAGAG
ACAAAAACCAAAATTTAATCACACTTTTCAAATTACCCGTCATGGTTCAATCCATGTATT
GCAGTCTTGCAGGAGAAAATCTTGAAGGTAGAATCAAACACGGTGAATGTTAATTTGATT
AAGGTGGTTATTTCATTATCAAAGGTTCAGAAAAAGTCATCATTGCTCAAGAACGTATGG
CCTTCAACTTCGTTTATGTCTTCCAACAAAAAGATCCAAAAATGCCTTGGATAGCAGAAG
TAAGATATCATATTCATTTTAAAACAAATCATATAACAGAATGAAATTTCAATAAGAAAT
ATTCGTTTAATCACTTTGAAACTAAATTATAAGCAAAAAATATAATTTAAATCTATTAAA
AAAAAATATTTTTTAGAGTTAAAAATATGAATTAATTTAACAAATGAAAGTAAGTAACTT
AAAGGATAATCAATAGATAAAGATAAATAGACGCATTAATATTTGATTTTTATTCAAATT
TATTTAAACTAAATAAATAATTTGGTTATTTTAAAATGAAAACAGATCAGATCAATCAGA
GACAAAACTAATGCTGTTTAATCTAAATTTGCTTTAAAATTAAAACTTAGAGACGGAGAA
TATCAACTTTATGCAAGATGCAAACTTATTAATGAAGATATCCCTATTTTCGTTTTACTT
AAAGCTCTTGGTTGTGTTGAAAGTGATAAGGAAATGATGGAACGTATATTTTATAATTTA
AAGGATCCTAAAAATGAATAAATGATGGAAATGCTTCGTTCCTCCCTCTTGCTCGCTCAA
CATTGTAACAATAAAAGAGAAGCCCTTATTTTCATCGGTTACAGAATTAATGCAACCACA
AATTATAGAGGATCTCAAGAAGCCATGCAATCAGCAGAAGATACTCTTAAGCTTTACTTA
CTCCCTCATATTGGTACCCAAGAATCTGATAATGATAAAAAGCTTTTCTTCATTGGATAT
ATGGTATTATTTATTTATTAATCTATAGTTAATACATTGTTATTTATTACACAGATGTTG
ATCTGTTTGAAATAAATTATTTATTTATTACACAGAAGTTTTTCTGTTTGTAATTTTTAA
AAATATTTTGCTTAAAAATTTCATTTTTTGCTCTTAAATCAAAGCTAAGTTTAATATTTT
AAATTAAAAAAAAAGATTTAAAAATTGTTAAATGCTGCTCTTGGCAAGACTCAAGAAGAT
GATAGAGATCACTATGGTAAAAAGAGATTGGATATGGCTGGTGCACTTATCAGTTAGTTA
TTCAAGGAAAGACTTAGAATATTCCAAAAGAATGCAAAGAAGAATTTGCAATAAAAAATA
AATGACATATCTAGAGATGCTCAAAAATCTCTTAATGTTATTGTAGATATTTTCGATCAT
AAGTTGATTTCAGATCATATTAGATTGGCTCTAGCCACTGGTAATTGGGGTTAGACAGCA
GACGGAGAAGTAGTCAAAACTGGTGTTGCTTAGGTATTAAAAAGAGATACTTCATTATTC
GCAACTATGTCTCACATGAGAAGAGTTAATGCTCCTATGAAATCAGCTGCTAAGCTTGCC
AGACCTCGTTAATTGCACAATACTCACTACGGTTTAATTTGCCCTGCTGAAACTCCTGAA
GGTTAGAAAATTGGTATGGTTAAAAACTTGTCTCTATTGGCTTAAGTTTCCCTAGGTCTA
AGTTCTTAGGATAACTTAAAGATTCAAGAATAGTTAGAAGAACAAATTAACTAATTTGAT
ATTCTTAATCTTAAGCTTGAAAAGATTCCTTACTAAACAAAAGTGTTCTTCAATGGTAAT
TGGATTGGTTTTACCGAAACACCTGAATAAATTATTGATGTCTTTAAGGAAATTAGAAGA
TTGCAAAAAATCGATGGTTTTTCTATTGTCAGAGATATTATTAACAAAGAAATCAGGTAG
ATTAATTAATTATTTATGTGCATTTTATCAACATTAATTGCTAGATCATACAAAAACATA
CATAAATGTCTTTTTTATTTTTTATTTAACGTAATCATTTTTTTTAATTGATAGAATTTA
CACTGATCAAGGTAGAGGTATGAGACCAGTTTTTACTGTGTAAGAAATCTGTGAAGGAAA
AAATAGACTCAAGATTACAAAATCTAAATTATATGCTATCCTCCAGTAATTTGAAGGCAA
GGCATTTTAAAAATTAATTGATGAAGGTTTTATTGAACTTTTGGACGTCGAAGAAGAAGA
AGGTGCTTTAATTGCTGTAGATATAAATGATTTTTACCACACTGATGATCCAAGAAGAAC
TAATCTTCCTTTCACTCATTGCGAAATTCACCCTGCTATGATTCTTGGTGTCTGTGCTTC
CGTTATTCCTTTTGGACATCACAACTAAGGTCCAAGAAATACTCTTTAATCTGCTATGGG
TAAACAGGCTATGGGTAAATTTTTCTATTTGCTAAATACTATTTATTTTATATTAAAATT
GATTGATTGATTAATTGATTTAAAATTGCTATAAATTAATTTAGGTTTAAATTCAACTAA
TTTCCATATGAGACTTGACACTCTTTGCCATATTTTGTACTATCCTCAAATTGCACTTGC
TTCAAGTAAATCTCTCTAATACATTACTGCTAAAGATATTCCTATTGGAAGTAATGCAGT
TGTAGCTATTGCTTGCTTTACTGGTTACAACCAAGAAGATAGTATTATCATTAATTAGAG
TGCCATAGATAGAGGTCTCTTTAGATCTATCCTCTACAGAACTTACAAAACAACAGAAAA
GAAAGAACATATGGGTCTTAATCCTGTCATTGAACATATTAGATTCCCCGATGAAAAGAA
AACTATCATCCCTGCAAGTTATTCGTTCCTTAAATTGGACTATGATGGAATCATACGTAC
TTCATTTTATATTTAGAAATTTCAAAATTGAAAGAATTCACTTTACTTAAAACAAGATTT
TAAATTTTAAATCAATTAAATTATTTTTGTTAAAATAAAGCACCTGGAACTTAAGTAACT
GGTGAAGATGTCTTGATTGGTAAAGTTGTTGAATTACCAAAGACTGAAGGATCTGACAAA
TAATATAAGGATGTTTCTTTGGGATGCAGAAGATCTGAAATTGGTTATGTTGACACTGTT
ATTCTCTCAGAAGATAAGGATGGTATGTATATTGTAAAGGTCAAGCTTCGTTCTAATAGA
ATTCCATAAATTGGTGATAAATTTGCTTCCCGTCATGGTTAAAAAGGTACATGCGGTATG
ACTATTAGAGGTGAAGATTTGCCATACAACATTGAAGGTATCATTGCTGAATTGGTTATT
AATCCACATTGTATTCCCTCTCGTATGACTATTGGTCATATGATTGAAGGTCTTAATTCA
AAGCTATCTTCTTTAAAGGGTATTTGGGGTGATGCTACTCCATTCTCTGGCATTAAATTA
CAAGATATTGCCTCCGAACTTCACACTTATGGATATCAAAGATATGGTAATGAAGTCTTG
TACAATCCTTACACAGGTATGAGACTCTCTACTTAAATTTATTATGGTCCTACTTTCTAT
CAACGTCTTAGACATTTAGTCGATGATAAAATGTATTCTCGTTCTAGAGGTCCAGTTGTA
GCAATTGTCAGACAACCTACTCACGGTCGTTCCAGAGGTGGTGGTTTACGTTTTGGTGAA
ATGGAAAGAGATTGTATCATTGCTCACGGTAAATTTATCTCATAATTCTATTTAAATCTT
GTTTTTATTAAATGATATTATTTAAAATTTACTAGGTACCAGTAATTTCTTAAAAGAAAG
AACATTTGGCGTTTCTGATCAGTTCAGAACCCATGTTTGCTCAAGATGTGGTTTGTTTGC
TAAAGCAGATGTTACAAATCACAAGTATGACTGTACTGGCTGCTCTTAAGGTGATAAGAA
GCACTACAAAATCGTCCAAGTGTATCTCCCATATGCAGCTAAGCAACTTATTCAAGAACT
TATGGCTATGCATATTGTTCCAAGAATTAAAGTTGATGTCACTAGTAAAAAGTATGTTTG
A