Identifiers and Description

Gene Model Identifier

TTHERM_00522180

Standard Name

RPB10 (RNA polymerase II subunit 10)

Aliases

PreTt12333 | 65.m00151 | 3717.m00030

Description

Subunit shared in RNA polymerases I, II & III

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.2%

TetraMine Data

TTHERM_00522180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12890.13.9991604984848653e-48RNA polymerase N/8 kDa subunit
protein (74 aa)
OxytrichaContig4686.0.g382.0009605191578312e-25RNA polymerases N / 8 kDa subu
nit
SGDYOR210W9.002093297142233e-23RPB10 RNA polymerase subunit A
BC10-beta, common to RNA polym
erases I, II, and III
DictyBaseDDB_G02720361.0002869940498747e-21rpb10 on chromosome: 2 positio
n 1094076 to 1094714
WormBaseWBGene000213477.002638123733849e-21locus:rpb-10 DNA-directed RN
A polymerases I, II, and III s
ubunit RPABC5 status:Confirm
ed UniProt:Q9GR61 protein_
id:CCD73423.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00522180(coding)
ATGATTATCCCAGTTAGATGCTTTACTTGTGGCAAAGTTGTTGGCCATATGTGGAATGAC
TTCTTATAAATGATCAGCGAATCTAACCCTAATAAAAAGGATATGAAGAGTGCTTTAGAT
GAATTAAGATTAAATAGATATTGCTGCAGAAGAATGATTCTCACTCACTGTGATTTAATT
GATAAGTTACTTAACTACAACATTTACAAGGGTCAAAGTTGA


>TTHERM_00522180(protein)
MIIPVRCFTCGKVVGHMWNDFLQMISESNPNKKDMKSALDELRLNRYCCRRMILTHCDLI
DKLLNYNIYKGQS


>TTHERM_00522180(gene)
ATGATTATCCCAGTTAGATGCTTTACTTGTGGCAAAGTAAATAATTAGCTTGTATTTCAT
GAACTAGAATAGTGATTTTGAATCTATCTTCAATATGATGATGAAATTTTTTAAAGCCAA
ATGCATCTTTTTCTACTAAAATGCTAAATTATTATATTATTTTATAATAGGTTGTTGGCC
ATATGTGGAATGACTTCTTATAAATGATCAGCGAATCTAACCCTAATAAAAAGGATATGA
AGTAAAAATAAATAAATTATCGATTGAAAAGCTCAATTTAATCTAAAATTGTTTTTATAA
AATGCAATTAGGAGTGCTTTAGATGAATTAAGATTAAATAGATATTGCTGCAGAAGAATG
ATTCTCACTCACTGTGATTTAATTGATAAGTTACTTAACTACAACAGTAAAATGAATTAA
ATAAAATCTACTATCTATTAAAATTATTTTATTTTAACAAAGTTTACAAGGGTCAAAGTT
GA