Identifiers and Description

Gene Model Identifier

TTHERM_00538940

Standard Name

RPB1 (RNA polymerase II largest subunit)

Aliases

PreTt12151 | 70.m00147 | 3728.m00046

Description

Largest subunit of RNA polymerase II

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF02948 ) amelogenin
  • ( TIGR01612 ) rhoptry protein
  • ( PF00623 ) RNA polymerase Rpb1, domain 2
  • ( PF04983 ) RNA polymerase Rpb1, domain 3
  • ( PF04992 ) RNA polymerase Rpb1, domain 6
  • ( PF04997 ) RNA polymerase Rpb1, domain 1
  • ( PF04998 ) RNA polymerase Rpb1, domain 5
  • ( PF05000 ) RNA polymerase Rpb1, domain 4
  • ( TIGR00071 ) tRNA pseudouridine synthase A
  • ( PF03478 ) Protein of unknown function (DUF295)
  • ( PF08265 ) YL1 nuclear protein C-terminal domain
  • ( TIGR02390 ) DNA-directed RNA polymerase subunit A'
  • ( TIGR02389 ) DNA-directed RNA polymerase, subunit A''
  • ( TIGR02386 ) DNA-directed RNA polymerase, beta' subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00538940

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_50810
WormBaseWBGene000001239.997093137033517e-262locus:ama-1 DNA-directed RNA
polymerase II subunit RPB1
status:Partially_confirmed U
niProt:P16356 protein_id:CCD
69532.1
Tetrahymena borealisEI9_18204.19.997093137033517e-262RNA polymerase Rpb1, domain 2
family protein (1758 aa)
DictyBaseDDB_G02791939.997093137033517e-262rpb1 on chromosome: 3 position
1783778 to 1789076
OxytrichaContig18775.0.g499.997093137033517e-262RNA polymerase Rpb1, domain 5
SGDYDL140C9.997093137033517e-262RPO21 RNA polymerase II larges
t subunit B220, part of centra
l core; phosphorylation of C-t
erminal heptapeptide repeat do
main regulates association wit
h transcription and splicing f
actors; similar to bacterial b
eta-prime

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00538940(coding)
ATGAAATAGTCTGGACAAAAGTATGCTTACTCCTAGATGGAGACAGCCAAAGTTAATGGC
GTCCATTTCTCTATTCTCTCTGAAAAGGAAATAGAAAGCTGGTGCGTTTGTGAAATTAAA
AATTTTGAAAATGGTAATAAAGAAGATGAAGGCTTTATAAACGATAAAAGATTAGGTACT
ACCTCTAAGGATGCATGCAAAACTTGTAATTAAAAGAATGAATGTCCTGGTCATTTTGGT
TACATCAATCTTAGAAGGCCTATATATCATATCAATTTCATAAACACAGTCAAGCAAATT
CTTCTCTGCGTCTGTCACAAATGTGGTGCTGTAAGAGAGCCCCCTATTAAGAGAAATGAG
AGTGGTAAACCTGCAAGTAAAACAGAATTTGCTAAACTTGAAAAGTATTTAGAAGTTATG
AATATTTCTTAGCCTAAGAGAAGACTTAATGAATTGTATAAAATCCTTGGAAAATAATCC
AAATGCCAAAACGATAAGTGCAACTCATATTTATTTGTTAAAGTCAGTGTAGTGAAGTTC
TTAAATCTTAAAGTAGCTGAAAAGTAAAGTGATAAGGATGCTATTGAGTATGATCTGAGT
GCAGAATAAGCATTAGAAATTTTAAAGAAGATTAGATATGCTGACTCCAAAAAGTTATTA
GCTTACAAAGGATAAAGAAAACATGATGACGATTTCTTGTAGCCAACTAATCTTATCTTA
ACAAAGTTGCTTGTACCTCCACCCTAAGTTCGCCCTTCTATTGAAATGTCATCTAATATG
ACCTGTCAAGATGAACTCACTAAATGCTATGAAGAAGTATTGAAGCTAAATGCATAAATT
AAAGATAATTCTGATAACAGAAAGCTGGTTGAGTAAATCTAGAGTGTTGTTGCCAGAATG
ATGGATAACGATAAACCAAGATTAGAAGCACTTAAAATTAAATCAAAGGTTGTTAAAAGT
TTTTCTTAGAGATTAAAAGGAAAAGAAGGTAGATTTAGATAAAATTTAATGGGTAAAAGA
GTAGATTTTTCTGCAAGATCTGTTATTTCCCCAGATGCAAATTTATGGTTGGATGAATTA
GGTGTTCCTAGAAGTATTGCTGACAGTTTGACTGTTCCTGAAATAGTTAACTAACAAAAT
ATAAACAGAATTCGTGAATTATGGAAGTAAGGCAAAATTAAAAGTATTATGAAACCTAAT
CGTGAAAAATAGATTTATGAAGCTTACGATGCTATTATTTGCAGTGGTGATAGATAAGCT
GATGATAATTTTGACATGCACGTTAATGATGGTGTTATTATTGAAAGAGCCTTATAGAAT
GGTGATTATGTGCTATTTAACCGTTAGCCCTCTCTCCATAAAATGAGTATGATGGGACAT
AGAGTTAGAATTCTTCCTTACAGTACTTTCCGTCTTAACTTATCAGTCACAACCCCTTAT
AATGCAGATTTTGACGGTGATGAAATGAATATGCATGTGCCATAATCTTATGAAACTCGT
GTTGAACTTGGTTATATTTGCCATGTTCCTAGATAAATTGTCACTCCCAAGGCTAACAAA
CCAGTTATGGGTTTGGTGCAAGATTCATTATTAGGTGTAGCTATGTTTACTTTAAGAGAT
AAGTTTTTAACAAGAGAATAAGTTATGAATTTAGTTATGTGGATTGACAATTGGGAAGGA
GACCTACCCATGCCTGCTATTCTTAAACCTGAACCTTTATGGACTGGTAAATAAATTATG
TCTTTAGTCATTCCTGAATAAATGACTATGACCAGATTCAAAGGTGACAAGGAAGATGAC
AAGTGGTTCCATAAATAGGATGAATCTATTTACATCTACAAAGGTGAACTAATTTAAGGC
TATATGAATAAGGCTATTGTTGGTGATGGTCCTGGTGGTTTAGTCCATTTGATTTGGTTA
GATATTGGTCATGAAGAAACTAAAAATTTCATGACTAGATGTTAGAGGGTAGTTAATAAC
TGGCTTATTATGTTTGGTCACACAATCAGTTGTGCTGATATCGTGCCTAGTGAAAAATGT
TCAGAAGAAATTGAAAAAATTAGAAAGAAAGCCTTTGAAAAATATGATAAAATTGAATTA
GATTTCTAAGATGCAGCTTATATTGATTAAAATAATATGCACAAGGCTGGTAAGAAGATT
TTTGATTCTTTCGAAGTTCAAGTTAACTCCATCTTGAATGAACTCAGACAAGAATCCGAA
AAGAAAGCAGAAGAAACAATTAAATTCAAGTACAACTAATTCAACAAGATGGTGTGGTCA
GGTTCAAAAGGTAAAGCTACTAACTTAGCCTAAGTCATGGGTCTTGTAGGTTAACAAAAT
ATTGAAGGTGCTAGAATCAGGAATGGTTTTTCAAGAAGAACTCTTCCTCATTTCTGCAAA
GATGATAATGGTATTATTGCAAGAGGTTTCGTCGTTAACAATTTCTACATAGGTTTAAAG
CCCTACGAATTCTTCTTCCACACAATGGGTGGTAGAGAAGGTCTTTCTGATACTGCAGTC
AAGACAAGTAGAACTGGTTATATTTAAAGAAAGCTTGTCAAGGCTCTTGAAGATGTCATC
GTACGTTATGATGGTACAGTTAGAGATAGTTAGGGTATGATTATTTAAACATGCTATGGT
GAAGATTCATTGGCAGGTGAATTCATCGAAACCTAAAAGATCGGAGAAGTTGATTATAAG
GAAGAAGATTTCCAAAAGGAATACAGATTTGTCAAAGCAAATAAAAGCGACGACTGGTTA
TTCCAATATACAAAATTGGACTAGATGGAAAATCAAATTAGCAAAGAAATCAGTAGAGAT
GTTTTAATTGCAATCAAGGAAGAATTTATGCGTATGATTAACGAAAGAAACGAAGGAGAA
GATCCTAAATTTATCTTAGAATAAGAGTACGAAGAACTCATCGAAGCTAGAAACCTGTTT
AGAAAGAATTTCTACTTCTACGCATAAGAAGGCAAACTTGATATTAACTTGCCAGTCAAC
ATTGGTAGAATGATTGAATCTGCTAAAATTGAAATGTCTTAAAAGAATAAAACTTATACT
AGAGATTAATGTAAGACTAATCCTATTTAAGTTTATAAGAGTCTCTTAGAATTATTTAAG
AATCTTGATGACTATGCAGTTAAAAGAGGTATGGAGTATGAATCTTTGGCTTTGTTCAAG
GCTCATATCCGTCTCCATCTTGGTTCCAAAAAGATAGTATTAAGGCATAAGCTTTCAATG
GAAGTATTTGATAAACTCACAAAGGAAATTTTTGATAAATTTAAAAAAGCCATTTCTCAC
CCAGGTGAAACCATTGGTGCTATTTCAGCTTAATCTGTAGGTGAACCCACAACATAAATG
ACTTTGAATACTTTCCACTTTGCAGGTGTGTCAGATCGTAACGTTACGCTTGGTGTCCCT
CGTCTTTAGGAAATATTAGATGCTTCTAAAAATGTAAAGACACCAGAAATGACTGTCTTC
TTTGAAAATGGTTTAAGAAAAAAAATTTTCAGGAAAGATATGATGAGCAACTATGATGCA
GAAAGCTTTAAGAGAGAATATGACGAAATTGTTTCGTAGGAAAGATAGGAAATTTTAAGA
CTTAAACAAGAGATTGAATACTAAACTATTTCTTACTACATTAATCAAACCAGAATTGTT
TATAAATCTAAAGATGATGAAGACTTTTAATAACAAGATAACATTTTCGATGATGATAAT
ATTTCTGATGATCTCGAAGATCCTATTGTCCTCATTATTTATTTTGATACTTAAAAGACA
ACAATTGATACTTTTGAACTCTTGAATGCAAAAATTAGAAAAATTGCTGATGACTCTAAA
AAGTGGGGTAACCTCATAGTTGAAAAGAAATAATTTGAAAAAGGACAAATTCATGTTAAA
TTTGACTCTACCCAATTAGGTTAAGGATAATAAAATCCAGATTCTTAAATGAACGCTTAT
TCTTCTCTCCTTCTCTTTGAATCCGAATTCAAGGATGCATACATAGGAGGTATTTAGAAA
ATCCAAAAAGTTTATCCTACCCAAAAGAAGGAATTCAGACCTTGGGTTGAAAATGAATGT
ATATGTGAAGCCCCCAAACCAGGTGCAGCTTTCTTCACAGAGAGAAAACCTTAAGAACAT
ATTTTCAATACTTCTGGTTCAAATCTCAAAGAAGTATTGAAGGTTGATAAAGTAGATGCT
ACTAGAACTTATTCTAACGATATCTAAGAAATCATTACCATTCTTGGTATCGAAGCAGGT
AGAAGATCTATTGTTAATTAAATTAGAGTCGTCATTGAACCTTATGGTATTTACATCAAC
TATCGTCATTTAGCTATTTTGGCTGAGTGGATGACTGTAAGAGGTCGTTTGACTCCTATT
AATAGAAACGGTATCAATCGTATTCCTGGTTTATCTTGCCTCAGAAAATCTTCCTTTGAA
GAGACAGTAGATATTCTCAACACAGCTGCCATTTTCTTTGAAAAGGATGATTTGAAAGGT
GTTACTGAAAATATTATCTTTGGTCAAAATTGTGATATTGGTACTGGTTGCTTCGACTTA
TTAGTCGACTTGAATAAGGTTGGTGAATTTAAAACAAAGAGATAGGTTGAATAGACATTA
GAGATGGAAGATTATTCAGAAAACGAATCCTCTCGTTACGAAAATACTCCTTCTCATTTC
CAAACTCCTGGTCCCGGTCTCGTTTCTGCTTATCCTAATTCTATTAGAACAGTATAACAT
GCTGGATCTTTCACTCCAACCACTCCCTACCTAAACTCTCCTGGATACAATATGTCAACT
CCTATCTCTTACTCTAACACCTATAACCAAACCAGAAGTTCTTAATATAGTCCTCAGACA
GGCAATAATTCTCCATTTGTTCCTTCTCCAAACTACTCACCTCCAAGCCACACTCCAGCT
GGTTCAACAAGCCCTGCAAACGCTAGTCCTTATGCAAGCTCACCTTAATATAAAAGCAGT
AGTCTTAGTGGAGCTCACTCTCCCTCTTACACTTCACCTTCACAAGTGAGATATAATTCC
CCAAGTTATCAAAATCCTCATGCTAGTTCATCTAGTCCACTTGATAGATCTAAGTCAGCT
TATATGGGATCCTAACAATCACCTTAATACATGAGTTCTCCTCACTATGAATAGAGAACA
ACTCCTATGACTAGAAATATTAAAAGCGAAACTTCTTACAATCCAACTGAAGAAAGGGAA
AGTGAAGAAAGTGATTCTGATCAAGATTGA


>TTHERM_00538940(protein)
MKQSGQKYAYSQMETAKVNGVHFSILSEKEIESWCVCEIKNFENGNKEDEGFINDKRLGT
TSKDACKTCNQKNECPGHFGYINLRRPIYHINFINTVKQILLCVCHKCGAVREPPIKRNE
SGKPASKTEFAKLEKYLEVMNISQPKRRLNELYKILGKQSKCQNDKCNSYLFVKVSVVKF
LNLKVAEKQSDKDAIEYDLSAEQALEILKKIRYADSKKLLAYKGQRKHDDDFLQPTNLIL
TKLLVPPPQVRPSIEMSSNMTCQDELTKCYEEVLKLNAQIKDNSDNRKLVEQIQSVVARM
MDNDKPRLEALKIKSKVVKSFSQRLKGKEGRFRQNLMGKRVDFSARSVISPDANLWLDEL
GVPRSIADSLTVPEIVNQQNINRIRELWKQGKIKSIMKPNREKQIYEAYDAIICSGDRQA
DDNFDMHVNDGVIIERALQNGDYVLFNRQPSLHKMSMMGHRVRILPYSTFRLNLSVTTPY
NADFDGDEMNMHVPQSYETRVELGYICHVPRQIVTPKANKPVMGLVQDSLLGVAMFTLRD
KFLTREQVMNLVMWIDNWEGDLPMPAILKPEPLWTGKQIMSLVIPEQMTMTRFKGDKEDD
KWFHKQDESIYIYKGELIQGYMNKAIVGDGPGGLVHLIWLDIGHEETKNFMTRCQRVVNN
WLIMFGHTISCADIVPSEKCSEEIEKIRKKAFEKYDKIELDFQDAAYIDQNNMHKAGKKI
FDSFEVQVNSILNELRQESEKKAEETIKFKYNQFNKMVWSGSKGKATNLAQVMGLVGQQN
IEGARIRNGFSRRTLPHFCKDDNGIIARGFVVNNFYIGLKPYEFFFHTMGGREGLSDTAV
KTSRTGYIQRKLVKALEDVIVRYDGTVRDSQGMIIQTCYGEDSLAGEFIETQKIGEVDYK
EEDFQKEYRFVKANKSDDWLFQYTKLDQMENQISKEISRDVLIAIKEEFMRMINERNEGE
DPKFILEQEYEELIEARNLFRKNFYFYAQEGKLDINLPVNIGRMIESAKIEMSQKNKTYT
RDQCKTNPIQVYKSLLELFKNLDDYAVKRGMEYESLALFKAHIRLHLGSKKIVLRHKLSM
EVFDKLTKEIFDKFKKAISHPGETIGAISAQSVGEPTTQMTLNTFHFAGVSDRNVTLGVP
RLQEILDASKNVKTPEMTVFFENGLRKKIFRKDMMSNYDAESFKREYDEIVSQERQEILR
LKQEIEYQTISYYINQTRIVYKSKDDEDFQQQDNIFDDDNISDDLEDPIVLIIYFDTQKT
TIDTFELLNAKIRKIADDSKKWGNLIVEKKQFEKGQIHVKFDSTQLGQGQQNPDSQMNAY
SSLLLFESEFKDAYIGGIQKIQKVYPTQKKEFRPWVENECICEAPKPGAAFFTERKPQEH
IFNTSGSNLKEVLKVDKVDATRTYSNDIQEIITILGIEAGRRSIVNQIRVVIEPYGIYIN
YRHLAILAEWMTVRGRLTPINRNGINRIPGLSCLRKSSFEETVDILNTAAIFFEKDDLKG
VTENIIFGQNCDIGTGCFDLLVDLNKVGEFKTKRQVEQTLEMEDYSENESSRYENTPSHF
QTPGPGLVSAYPNSIRTVQHAGSFTPTTPYLNSPGYNMSTPISYSNTYNQTRSSQYSPQT
GNNSPFVPSPNYSPPSHTPAGSTSPANASPYASSPQYKSSSLSGAHSPSYTSPSQVRYNS
PSYQNPHASSSSPLDRSKSAYMGSQQSPQYMSSPHYEQRTTPMTRNIKSETSYNPTEERE
SEESDSDQD


>TTHERM_00538940(gene)
ATGAAATAGTCTGGACAAAAGTATGCTTACTCCTAGATGGAGACAGCCAAAGTTAATGGC
GTCCATTTCTCTATTCTCTCTGAAAAGGAAATAGTACATATACATTCTATAAAATTATTT
TTTTATGCAAGATTAGAATTTATTATTTAAATGGACTTCAAATATTAAGATTTACATTAG
AGGGAATATTAATTTTTAAAATTTAATGCATATTTCAAATCTTAGAATATACTTTTTAAA
AATGGATATAAATTTTTTATAGCTATTGTTTTACTATTTGATTGTAATAAGCATAAAATG
AATGTTTCAAGATTTAGCATAATTAAATAATAAGTCTATTTAAATAAATTGGAGTTTGCT
TATTCTTAGCGGTTCAAAGAGCAATCATTAAATTATTTCATAAAATAAAATAGGAAAGCT
GGTGCGTTTGTGAAATTAAAAATTTTGAAAATGGTAATAAAGAAGATGAAGGCTTTATAA
ACGATAAAAGATTAGGTACTACCTCTAAGGATGCATGCAAAACTTGTAATTAAAAGAATG
AATGTCCTGGTCATTTTGGTTACATCAATCTTAGAAGGCCTATATATCATATCAATTTCA
TAAACACAGTCAAGCAAATTCTTCTCTGCGTCTGTCACAAATGTGGTGCTGTAAGAGAGC
CCCCTATTAAGGTGAATTATTATAGCAATACATTATTTTTTTCTTACAATTCGGCTGTAT
TTCTCCCTAAAATGAAATCAATTTTGCTAAAATTACCTTTGATTGTATAATTTATGAATT
CAATTCTACCGCCTTTAAAAAAAACTTAACTCATAACATCGAAATTACAAATTGCATGAA
AAAAGGAAGCATTTATAAAATAAATTAGACACAACTCAATTTTAATTTAATTGTGTTTGT
TTTTTAGAGAGAAAACAGCTTCAACATAAAGAGAAAAATAAATCATTTAATTTCTATTTA
TAAAGAATATTCAATATTAAACAATAGAGAAATGAGAGTGGTAAACCTGCAAGTAAAACA
GAATTTGCTAAACTTGAAAAGTATTTAGAAGTTATGAATATTTCTTAGCCTAAGAGAAGA
CTTAATGAATTGTATAAAATCCTTGGAAAATAATCCAAATGCCAAAACGATAAGTGCAAC
TCATATTTATTTGTTAAAGTCAGTGTAGTGAAGTTCTTAAATCTTAAAGTAGCTGAAAAG
TAAAGTGATAAGGATGCTATTGAGTATGATCTGAGTGCAGAATAAGCATTAGAAATTTTA
AAGAAGATTAGATATGCTGACTCCAAAAAGTTATTAGCTTACAAAGGTATTAAGATTTTT
AGTTAATACTTTGTAATCAAAAACCAAATGAGAGTTTTAAAATACAATCATATTTATTGA
TGATTATATTTGAATACTTCTTTTATATGTAAGTGAAATATTTTTTATATTAAAAGGATA
AAGAAAACATGATGACGATTTCTTGTAGCCAACTAATCTTATCTTAACAAAGTTGCTTGT
ACCTCCACCCTAAGTTCGCCCTTCTATTGAAATGTCATCTAATATGACCTGTCAAGATGA
ACTCACTAAATGCTATGAAGAAGTATTGAAGCTAAATGCATAAATTAAAGATAATTCTGA
TAACAGAAAGCTGGTAAATAAAACATTTTTTTAATAATTTATATTTGTTTTAAAAAATAA
AAAATCTCAGTATATAGTTTAGCAAAAATTTATTAAAATTTTAGATAGATAATATTAATT
AATATTTAAAAAGAGCAAGAATATCTTTAAAAATATAAAGCTTTATAAAATAAAATATTT
AAATGCTAAGCGAACATATTTTATGATGATATAAATTGTTTTTAGATTATGAAGTTAATT
TTGATTTTTTGTTTAAAAGGTTGAGTAAATCTAGAGTGTTGTTGCCAGAATGATGGATAA
CGATAAACCAAGATTAGAAGCACTTAAAATTAAATCAAAGGTTGTTAAAAGTTTTTCTTA
GAGATTAAAAGGAAAAGAAGGTAGATTTAGATAAAATTTAATGGGTAAAAGAGTAGATTT
TTCTGCAAGATCTGTTATTTCCCCAGATGCAAATTTATGGTTGGATGAATTAGGTGTTCC
TAGAAGTATTGCTGACAGTTTGACTGTTCCTGAAATAGTTAACTAACAAAATATAAACAG
AATTCGTGAATTATGGAAGTAAGGCAAAATTAAAAGTATTATGAAACCTAATCGTGAAAA
ATAGATTTATGAAGCTTACGATGCTATTATTTGCAGTGGTGATAGATAAGCTGATGATAA
TTTTGACATGCACGTTAATGATGGTAAATATTATTAATTTCATTCTTTTTAGATTATAGT
TATTGTTCATAAATAAAAATAGGTGTTATTATTGAAAGAGCCTTATAGAATGGTGATTAT
GTGCTATTTAACCGTTAGCCCTCTCTCCATAAAATGAGTATGATGGGACATAGAGTTAGA
ATTCTTCCTTACAGTACTTTCCGTCTTAACTTATCAGTCACAACCCCTTATAATGCAGAT
TTTGACGGTGATGAAATGAATATGCATGTGCCATAATCTTATGAAACTCGTAAATATGAT
TGAATTGAAAATATCTTTTTAAAAAGTTAATTTAAATATAAAGGTGTTGAACTTGGTTAT
ATTTGCCATGTTCCTAGATAAATTGTCACTCCCAAGGCTAACAAACCAGTTATGGGTTTG
GTGCAAGATTCATTATTAGGTGTAGCTATGTTTACTTTAAGAGATAAGTTTTTAACAAGA
GAATAAGTTATGAATTTAGTTATGTGGATTGACAATTGGGAAGGAGACCTACCCATGCCT
GCTATTCTTAAACCTGAACCTTTATGGACTGGTAAATAAATTATGTCTTTAGTCATTCCT
GAATAAATGACTATGACCAGATTCAAAGGTGACAAGGAAGATGACAAGTGGTTCCATAAA
TAGGATGAGTAATAATTAGTTAAATTTTATTTTAATTTACATCTATCTTATTTATATTTT
ACATAAACGATTAATTTAATAAACAGATCTATTTACATCTACAAAGGTGAACTAATTTAA
GGCTATATGAATAAGGCTATTGTTGGTGATGGTCCTGGTGGTTTAGTCCATTTGATTTGG
TTAGATATTGGTCATGAAGAAACTAAAAATTTCATGACTAGATGTTAGAGGGTAGTTAAT
AACTGGCTTATTATGTTTGGTCACACAATCAGTTGTGCTGATATCGTGCCTAGTGAAAAA
TGTTCAGAAGAAATTGAAAAAATTAGAAAGAAAGCCTTTGAAAAATATGATAAAATTGAA
TTAGATTTCTAAGATGCAGCTTATATTGATTAAAATAATATGCACAAGGCTGGTAAGAAG
ATTTTTGATTCTTTCGAAGTTCAAGTTAACTCCATCTTGAATGAACTCAGACAAGAATCC
GAAAAGAAAGCAGAAGAAACAATTAAATTCAAGTATATTTATTTATTTACTTTTAAAAAT
GTAACTCTAAAAAATCTAAAATAGGTACAACTAATTCAACAAGATGGTGTGGTCAGGTTC
AAAAGGTAAAGCTACTAACTTAGCCTAAGTCATGGGTCTTGTAGGTTAACAAAATATTGA
AGGTGCTAGAATCAGGAATGGTTTTTCAAGAAGAACTCTTCCTCATTTCTGCAAAGATGA
TAATGGTATTATTGCAAGAGGTTTCGTCGTTAACAATTTCTACATAGGTAAATAAATATT
AAAAAATAAATGTAATAATTGTTTTAAATATATACAGGTTTAAAGCCCTACGAATTCTTC
TTCCACACAATGGGTGGTAGAGAAGGTCTTTCTGATACTGCAGTCAAGACAAGTAGAACT
GGTTATATTTAAAGAAAGCTTGTCAAGGCTCTTGAAGATGTCATCGTACGTTATGATGGT
ACAGTTAGAGATAGTTAGGGTATGATTATTTAAACATGCTATGGTGAAGATTCATTGGCA
GGTGAATTCATCGAAACCTAAAAGATCGGAGAAGTTGATTATAAGGAAGAAGATTTCCAA
AAGGAATACAGATTTGTCAAAGCAAATAAAAGCGACGACTGGTTATTCCAATATACAAAA
TTGGACTAGATGGAAAATCAAATTAGCAAAGAAATCAGTAGAGATGTTTTAATTGCAATC
AAGGAAGAATTTATGCGTATGATTAACGAAAGAAACGAAGGAGAAGATCCTAAATTTATC
TTAGAATAAGAGTACGAAGAACTCATCGAAGCTAGAAACCTGTTTAGAAAGAATTTCTAC
TTCTACGCATAAGAAGGCAAACTTGATATTAACTTGCCAGTCAACATTGGTAGAATGATT
GAATCTGCTAAAATTGAAATGTCTTAAAAGAATAAAACTTATACTAGAGATTAATGTAAG
ACTAATCCTATTTAAGTTTATAAGAGTCTCTTAGAATTATTTAAGAATCTTGATGACTAT
GCAGTTAAAAGAGGTATGGAGTATGAATCTTTGGCTTTGTTCAAGGCTCATATCCGTCTC
CATCTTGGTTCCAAAAAGATAGTATTAAGGCATAAGCTTTCAATGGAAGTATTTGATAAA
CTCACAAAGGAAATTTTTGATAAATTTAAAAAAGCCATTTCTCACCCAGGTAAATATATT
TTTAAAATTAATTGGCAAGAAAATTTTTATTTGTTAATTTCATTTTATGCTTTTTTATTC
TGTTTCTTATGAGTTGGTTTAATTTTATTAAAGGTGAAACCATTGGTGCTATTTCAGCTT
AATCTGTAGGTGAACCCACAACATAAATGACTTTGAATACTTTCCACTTTGCAGGTGTGT
CAGATCGTAACGTTACGCTTGGTGTCCCTCGTCTTTAGGAAATATTAGATGCTTCTAAAA
ATGTAAAGACACCAGAAATGACTGTCTTCTTTGAAAATGGTTTAAGAAAAAAAATTTTCA
GGAAAGATATGATGAGCAACTATGATGCAGAAAGCTTTAAGAGAGAATATGACGAAATTG
TTTCGTAGGAAAGATAGGAAATTTTAAGACTTAAACAAGAGATTGAATACTAAACTATTT
CTTACTACATTAATCAAACCAGAATTGTTTATAAATCTAAAGATGATGAAGACTTTTAAT
AACAAGATAACATTTTCGATGATGATAATATTTCTGATGATCTCGAAGATCCTATTGTCC
TCATTATTTATTTTGATACTTAAAAGACAACAATTGATACTTTTGAACTCTTGAATGCAA
AAATTAGAAAAATTGCTGATGACTCTAAAAAGTGGGGTAACCTCATAGTTGAAAAGAAAT
AATTTGAAAAAGGACAAATTCATGTTAAATTTGACTCTACCCAATTAGGTTAAGGATAAT
AAAATCCAGATTCTTAAATGAACGCTTATTCTTCTCTCCTTCTCTTTGAATCCGAATTCA
AGGATGCATACATAGGAGGTATTTAGAAAATCCAAAAAGTTTATCCTACGTAATATTTTA
TATTTTTTTTCTATCTCTTTTATTTAATTATGTTAAAAATAAATAAATAAACAAACAAAC
ACATAACTATCAATTAATTATTTATTTTATATTTAATAGCCAAAAGAAGGAATTCAGACC
TTGGGTTGAAAATGAATGTATATGTGAAGCCCCCAAACCAGGTGCAGCTTTCTTCACAGA
GAGAAAACCTTAAGAACATATTTTCAATACTTCTGGTTCAAATCTCAAAGAAGTATTGAA
GGTTGATAAAGTAGATGCTACTAGAACTTATTCTAACGATATCTAAGAAATCATTACCAT
TCTTGGTATCGAAGCAGGTAGAAGATCTATTGTTAATTAAATTAGAGTCGTCATTGAACC
TTATGGTATTTACATCAACTATCGTCATTTAGCTATTTTGGCTGAGTGGATGACTGTAAG
AGGTCGTTTGACTCCTATTAATAGAAACGGTATCAATCGTATTCCTGGTTTATCTTGCCT
CAGAAAATCTTCCTTTGAAGAGACAGTAGATATTCTCAACACAGCTGCCATTTTCTTTGA
AAAGGATGATGTAATTAATTAATTAATCAAGAAATATTTTTAAATTATTATTTTCATATT
TTAAAGTTGAAAGGTGTTACTGAAAATATTATCTTTGGTCAAAATTGTGATATTGGTACT
GGTTGCTTCGACTTATTAGTCGACTTGAATAAGGTTGGTGAATTTAAAACAAAGAGATAG
GTTGAATAGACATTAGAGATGGAAGATTATTCAGAAAACGAATCCTCTCGTTACGAAAAT
ACTCCTTCTCATTTCCAAACTCCTGGTCCCGGTCTCGTTTCTGCTTATCCTAATTCTATT
AGAACAGTATAACATGCTGGATCTTTCACTCCAACCACTCCCTACCTAAACTCTCCTGGT
AAAATAATTTTGTTTTCAATCAACAGCATAATTTTTAATTTATAAATTAGGATACAATAT
GTCAACTCCTATCTCTTACTCTAACACCTATAACCAAACCAGAAGTTCTTAATATAGTCC
TCAGACAGGCAATAATTCTCCATTTGTTCCTTCTCCAAGTAATTTTTTTCCATTTTTTAC
AACTTTAAATCAGGAAAGAATTAATTTAATCTTGAAAAATAAATTTTAAAACCATAAAAA
TATAAATTAAAATTTTAATTTTTAATACTAATATCATAAAGACTACTCACCTCCAAGCCA
CACTCCAGCTGGTTCAACAAGCCCTGCAAACGCTAGTCCTTATGCAAGCTCACCTTAATA
TAAAAGCAGTAGTCTTAGTGGAGCTCACTCTCCCTCTTACACTTCACCTTCACAAGTGAG
GTATAAAAATAAAAAAAATACAATAAATTTTAATTTAATTATTAATAAAAAATGAAATAT
AAATTAGATATAATTCCCCAAGTTATCAAAATCCTCATGCTAGTTCATCTAGTCCACTTG
ATAGATCTAAGTCAGCTTATATGGGATCCTAACAATCACCTTAATACATGAGTTCTCCTC
ACTATGAATAGAGAACAACTCCTATGACTAGAAATATTAAAAGCGAAACTTCTTACAATC
CAACTGAAGAAAGGGAAAGTGAAGAAAGTGATTCTGATCAAGATTGA