Identifiers and Description

Gene Model Identifier

TTHERM_01075780

Standard Name

RPA2 (RNA polymerase I subunit 2)

Aliases

PreTt02690 | 219.m00043

Description

DNA-directed RNA polymerase I complex subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF02363 ) Cysteine rich repeat
  • ( PF09268 ) Clathrin, heavy-chain linker
  • ( PF04560 ) RNA polymerase Rpb2, domain 7
  • ( PF04561 ) RNA polymerase Rpb2, domain 2
  • ( PF04565 ) RNA polymerase Rpb2, domain 3
  • ( PF04567 ) RNA polymerase Rpb2, domain 5
  • ( PF06883 ) RNA polymerase I, Rpa2 specific
  • ( PF00562 ) DNA-directed RNA polymerase, beta subunit
  • ( PF04563 ) DNA-directed RNA polymerase, beta subunit
  • ( TIGR02013 ) DNA-directed RNA polymerase, beta subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01075780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_175150
WormBaseWBGene000087819.997093137033517e-262locus:rpoa-2 DNA-directed RN
A polymerase status:Partiall
y_confirmed UniProt:Q27493
protein_id:CAA99827.1
Tetrahymena borealisEI9_15329.19.997093137033517e-262DNA-directed RNA polymerase, b
eta subunit protein (1160 aa)
DictyBaseDDB_G02935609.997093137033517e-262rpa2 on chromosome: 6 position
3044865 to 3048492
OxytrichaContig2863.0.g309.997093137033517e-262RNA polymerase Rpb2, domain 6
SGDYPR010C9.997093137033517e-262RPA135 RNA polymerase I second
largest subunit A135

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01075780(coding)
ATGAAGGAATCATTAAGTAGAGAAGATCATATTGCTCGTGCAAAGCAATCAAATTTAGAT
TTTTCAAAAAAGCTTAAGTAAGCTGCCTTTGCTCACATAGACTCTTTCAACTTCATTTAC
GATGAAGGATTAAAAAAAATCACTTAGTACTTGTAGCCAGTTGAAATTATTAAAGAATAA
AGATCTGAAGAATACAAGTAGAGTTACTTGCCCTTTAAATCTATGAAGGTTTGGATTGAA
AACCTCGAAATAGCCACTCCTATCAGAGCCGATTCAGGTGTAGCTGAAGACAATAAATTA
ATGCCCGAAGAATGTAGAATAGGAAGAAAGACTTATGGAGCTCCTCTTTTCGCAAAGGTA
GCTCGTAGTATTGATGGAGGAAAGCCTGAAAGCATAAATATTAGATTAGGCGACATTCCT
ATCATCGTTAGAAGTGATCATTGCCATTTAGCAAAAATGACTCCTAAGGAATTAGTGAAA
GCTCACGAAGATTGCAATGAATTTGGTGGATATTTTATTGTCAATGGTAATGAAAAGATA
GTCAGAATGCTTATCCTTCAAAAAAGAAATTATCCTATTGCTTTTATCAGAGCAGGTTAT
GTTAATAGAGGTCCTAATTACACACCTTTTGCAGTTTAAATGAAGTGTGTGAGAGAAGAT
TTATACTCAAAAACAATTACTCTCCACTATGTTTCTGATGGTTCTGTTTTCTTGCGTATT
CTTCACAGAAAGCAAGAATTCTTGATTCCAGCTATCGTTATCCTTAAAGCTTTAGCTGAT
ATTTCTGACCTTCAAATTTACAATAAATTAGTTAAAGGTTAAAGCAGCAAGAGTGCTATT
AGTGATAGAGTTGAAGTACTTATTAGGGGTAGTAAAGCAATGAGTTTAAATACTAAGGAA
GAATGTTTGGCTCACTTAGGTAAAAATTTCAGAGTCGTACTCAACATCACTAACCCAGAA
ATTACTGATAAGCAAGTTGGTGAAATTTTCATGAATGAAAACATTTGCGTTCACTTAAAT
AATAACATCGATAAGCTCAACACTATTTGTGTTATGATTAGCAAATTATATGCCTTAGTC
AGTGATGAAATTTGTCCTGATAACTTAGATTCTTTGCAAAATTAGGAAGTCCTCTTACCT
GGTCATCTCTATATGATGATTTTAAGAGAAAAGTTAGAAGAAATGCTTTTAGGTATCCGT
GCTAAAGTTTTTAAGGATGGTTCTAGACCCGAAGAAGCTATTAGAATTCCTCATATCGCT
TACTTAAAAAAAGCCATTGAATTTTAAGGCTCTATTGGAAATAAAATTGAATATTTCCTC
TCTACTGGTAATTTAAAATCCCAAACTGGTTTAGATCTCATGCAAGCTAAAGGTTTCACA
ATTATAGCTGATAAGTTAAATAATATGCGTTTCTTGAGTCACTTTAGAAGTGTCCATAGA
GGTGCTTATTTTACAGAAATGAAAACAACAACAGTTAGAAAATTATTACCTGAAAATTGG
GGTTTCATTTGCCCTGTGCACACTCCTGATGGTGGTCCTTGCGGTTTGTTAAATCACATT
TCTTAATCATGCAAACCCCTTACCAGACCTGGGTATGATGGTAATATTCACTTCAATTTA
GTAACTCTCTGCACTGAGATAGGTATGAATCCTATTGTAAACGATTTGTCTATCGTATTC
CCTCCTACTTCTGTTACTATTATGCTTGATGGTAGAGTTATTGGTTATATTGAATCTAAA
AATGCATAAACATTCTGCCAATCATTAAAATATTTAAAAATTATGCAAGATCCTACTCGT
TTAATCCCTGCTGATTTGGAAATCGGTTATGTTCCTAAACTTAATCTTGAAAAACAAAAT
ATTTTCCCAGGTATCTTTTTACACACTAATGAAGCTCGTTTTGTTCGTCCTGTTAAGCAC
TTGAAATTAAATGCCTTAGAATGGATTACTCCTTTCGAATAAGTCCATCTTTCTATTGCT
TGCATTGAAGAAGATATTAGAAACGATACTGAATACTAAGAACTCTCACCTTCATACATT
CTTTCAATTTTACCTTCTTAAATTCCTTTCCTCAATTATAACTAATCCCCTAGAAATATG
TATCAGTGCTAGATGGCTAAGCAAACTATGGGTACTTCTATGCACAATTTCCCTTATCGC
TTTGATAACAGAATATATAGATTATTAAATGGTTAAATTCCTATGGTTAAAGGTATGGAT
CCTGAAAGTTATGGTCTTTCTGATTATCCTTCTGGAACAAATGCTATCGTTGCAGTTATC
AGTTATACTGGTTATGATATGGAAGACGCTATGATTCTGAATAAATCATCATACGAAAGA
GGATTCGGACATGGTTGTGTCTATAAAAACTACTCATACGATGTTGCTGAATTAAATAAA
GAAAAAAATTCTAAATTTAAGATGTTGAATGAAGTTAAAAATATTGACAAGAGTTAAATC
GCTGAAGGTTTAGAAGGTGATGGTATTCCAGCTATTGGATCAGTAATTAAAAAAGGCACT
GCTGTCTTCTAAATATATGATACTTAAAAAAATGCTATGAAAACTTTCTACCACAAGGAC
TCAGAATTAGGTAGATTAGATGGTATAGCTTTAGTCCATGATGAAAAAACTAAAGAACCA
AGAGTTGAATATAGAATTAGAATTCCCAGAAATCCTATTATTGGTGATAAATTCTCATCT
CGTCACGGTCAAAAAGGTGTTCTTTCTGTCCTTTGGCCTCATATCGATATGCCCTTCACT
GAAAGTGGTATTACTCCTGATGTTATCATTAACCCTCACGCTTTCCCCTCCAGAATGACA
ATTGGTATGTTAATCGAAAGTATGGCAGGTAAATCTGGAGCTCTTAATGGAAATATATTA
GAAACTTAACCTTTCTAAAATTATTAAGATGATGATATTGTTAATTATTTCGGTAAATAA
CTTTAATCTCATGGTTATAATTATTACGGTAACGAAGTTATGTATAGCGGTACATATGGT
TGCATGATGAAAGTTGATATCTATATGGGTATTGTATACTATCAAAGATTACGTCACATG
GTTTCAGATAAAGCTTAAGCAAGATCTACTGGTCCCGTTGATATGCTTACTTAACAACCT
ATTAAAGGTAGAAAGAGAGGTGGTGGTATTAGAATGGGTGAAATGGAAAGAGATGCTCTT
CTTTCTCACGGTATCTCCTTCTGTATGCATGATAGATTCTTAAACTGCTCAGATTATTCT
GAAGGTTATGTTTGTAATAGTTGTGGTTCATTGGTCTCAACATACCTACATACTAATTTA
ATGAGTGGTGAGGCTATTGATAGTTTCTATAATTACAATAAGGGTGTTTAAAAGTCAAAA
CCTAAATGCAGAAAGTGCCAAAATGCTGAGTGTTCTAAAGTAGTAATTCCTTTTGTATTA
AGATACTTGACTAACGAGCTTGCTGCTATGAATATCAAGCTTGCCTTTAAGCTTGAATGA


>TTHERM_01075780(protein)
MKESLSREDHIARAKQSNLDFSKKLKQAAFAHIDSFNFIYDEGLKKITQYLQPVEIIKEQ
RSEEYKQSYLPFKSMKVWIENLEIATPIRADSGVAEDNKLMPEECRIGRKTYGAPLFAKV
ARSIDGGKPESINIRLGDIPIIVRSDHCHLAKMTPKELVKAHEDCNEFGGYFIVNGNEKI
VRMLILQKRNYPIAFIRAGYVNRGPNYTPFAVQMKCVREDLYSKTITLHYVSDGSVFLRI
LHRKQEFLIPAIVILKALADISDLQIYNKLVKGQSSKSAISDRVEVLIRGSKAMSLNTKE
ECLAHLGKNFRVVLNITNPEITDKQVGEIFMNENICVHLNNNIDKLNTICVMISKLYALV
SDEICPDNLDSLQNQEVLLPGHLYMMILREKLEEMLLGIRAKVFKDGSRPEEAIRIPHIA
YLKKAIEFQGSIGNKIEYFLSTGNLKSQTGLDLMQAKGFTIIADKLNNMRFLSHFRSVHR
GAYFTEMKTTTVRKLLPENWGFICPVHTPDGGPCGLLNHISQSCKPLTRPGYDGNIHFNL
VTLCTEIGMNPIVNDLSIVFPPTSVTIMLDGRVIGYIESKNAQTFCQSLKYLKIMQDPTR
LIPADLEIGYVPKLNLEKQNIFPGIFLHTNEARFVRPVKHLKLNALEWITPFEQVHLSIA
CIEEDIRNDTEYQELSPSYILSILPSQIPFLNYNQSPRNMYQCQMAKQTMGTSMHNFPYR
FDNRIYRLLNGQIPMVKGMDPESYGLSDYPSGTNAIVAVISYTGYDMEDAMILNKSSYER
GFGHGCVYKNYSYDVAELNKEKNSKFKMLNEVKNIDKSQIAEGLEGDGIPAIGSVIKKGT
AVFQIYDTQKNAMKTFYHKDSELGRLDGIALVHDEKTKEPRVEYRIRIPRNPIIGDKFSS
RHGQKGVLSVLWPHIDMPFTESGITPDVIINPHAFPSRMTIGMLIESMAGKSGALNGNIL
ETQPFQNYQDDDIVNYFGKQLQSHGYNYYGNEVMYSGTYGCMMKVDIYMGIVYYQRLRHM
VSDKAQARSTGPVDMLTQQPIKGRKRGGGIRMGEMERDALLSHGISFCMHDRFLNCSDYS
EGYVCNSCGSLVSTYLHTNLMSGEAIDSFYNYNKGVQKSKPKCRKCQNAECSKVVIPFVL
RYLTNELAAMNIKLAFKLE


>TTHERM_01075780(gene)
ATGAAGGAATCATTAAGTAGAGAAGATCATATTGCTCGTGCAAAGCAATCAAATTTAGAT
TTTTCAAAAAAGCTTAAGTAAGCTGCCTTTGCTCACATAGACTCTTTCAACTTCATTTAC
GATGAAGGATTAAAAAAAATCACTTAGTACTTGTAGCCAGTTGAAATTATTAAAGAATAA
AGATCTGAAGAATACAAGTAGAGTTACTTGCCCTTTAAATCTATGAAGGTTTGGATTGAA
AACCTCGAAATAGCGTAATTAATTATGATTTATTCGTTTAATTACCTTTCATCTGCAAAC
CAAAAAGTGGTATTTTTTGAAGATTTGGTTTTCAAATCTTAAACAAGACTAATTTATTTA
TAAGTCCCATCAATGTTTTTTAAAAGAAATCTTCTACTTTAAAGAAAAGTACATTTTTTA
ATTTACTTTACAAACAGGACAGCATACCACAAAAACTAATAGAATAGAATCATTTTTATT
TCAAATATGATAAAATTTACTTTCGATTTTGACTTTTTTTTAAAGGAATTATAAAATAAC
AAATTGTCTAAGCAATACTTTATATTTAGTAGCTAATTTAACCATCTTCAAAAATAATTT
ATTTTCCAAGGTTTATAATTCCATTAAGATAGAATGATTTATTTGATACTTTTATATTTG
ATAATAATGATGATGGTGGATGATAAGGTTAATAATAGATAAATAAATTTAATGATATTT
CAAAAACAATTTCTTATAGTTGTAATGTTTTTAAACTTTTTTAATAATTATATTCTAGCA
CTCCTATCAGAGCCGATTCAGGTGTAGCTGAAGACAATAAATTAATGCCCGAAGAATGTA
GAATAGGAAGAAAGACTTATGGAGCTCCTCTTTTCGCAAAGGTAGCTCGTAGTATTGATG
GAGGAAAGCCTGAAAGCATAAATATTAGATTAGGCGACATTCCTATCATCGTTAGAAGTG
ATCATTGCCATTTAGCAAAAATGACTCCTAAGGAATTAGTGAAAGCTCACGAAGATTGCA
ATGAATTTGGTGGATATTTTATTGTCAATGGTAATGAAAAGATAGTCAGAATGCTTATCC
TTCAAAAAAGAAATTATCCTATTGCTTTTATCAGAGCAGGTTATGTTAATAGAGGTCCTA
ATTACACACCTTTTGCAGTTTAAATGAAGTGTGTGAGAGAAGATTTATACTCAAAAACAA
TTACTCTCCACTATGTTTCTGATGGTTCTGTTTTCTTGCGTATTCTTCACAGAAAGCAAG
AATTCTTGATTCCAGCTATCGTTATCCTTAAAGCTTTAGCTGATATTTCTGACCTTCAAA
TTTACAATAAAGTAAATTTTTATTTAATGATAAATTTATTAAGTATTATAGTTTAATGAA
TGATTTTTACATAAAAAAATAATTAAAATGAATGTAATATAATAGGAGTTATTAAATTTT
AAACAATATTAATTAAATAGTTAGTTAAAGGTTAAAGCAGCAAGAGTGCTATTAGTGATA
GAGTTGAAGTACTTATTAGGGGTAGTAAAGCAATGAGTTTAAATACTAAGGAAGAATGTT
TGGCTCACTTAGGTAAAAATTTCAGAGTCGTACTCAACATCACTAACCCAGAAATTACTG
ATAAGCAAGTTGGTGAAATTTTCATGAATGAAAACATTTGCGTTCACTTAAATAATAACA
TCGATAAGCTCAACACTATTTGTGTTATGATTAGCAAATTATATGCCTTAGTCAGTGATG
AAATTTGTCCTGATAACTTAGATTCTTTGCAAAATTAGGAAGTCCTCTTACCTGGTCATC
TCTATATGATGATTTTAAGAGAAAAGTTAGAAGAAATGCTTTTAGGTATCCGTGCTAAAG
TTTTTAAGGATGGTTCTAGACCCGAAGAAGCTATTAGAATTCCTCATATCGCTTACTTAA
AAAAAGCCATTGAATTTTAAGGCTCTATTGGAAATAAAATTGAATATTTCCTCTCTACTG
GTAATTTAAAATCCCAAACTGGTTTAGATCTCATGCAAGTAATATTTAAATTCATTTCTA
AAAAAATTTATATTGATTAAAAACTATCATAATAAAGGCTAAAGGTTTCACAATTATAGC
TGATAAGTTAAATAATATGCGTTTCTTGAGTCACTTTAGAAGTGTCCATAGAGGTGCTTA
TTTTACAGAAATGAAAACAACAACAGTTAGAAAATTATTACCTGAAAATTGGGGTTTCAT
TTGCCCTGTGCACACTCCTGATGGTGGTCCTTGCGGTTTGTTAAATCACATTTCTTAATC
ATGCAAACCCCTTACCAGACCTGGGTATGATGGTAATATTCACTTCAATTTAGTAACTCT
CTGCACTGAGATAGGTATGAATCCTATTGTAAACGATTTGTCTATCGTATTCCCTCCTAC
TTCTGTTACTATTATGCTTGATGGTAGAGTTATTGGTTATATTGAATCTAAAAATGCATA
AACATTCTGCCAATCATTAAAATATTTAAAAATTATGCAAGATCCTACTCGTTTAATCCC
TGCTGATTTGGAAATCGGTTATGTTCCTAAACTTAATCTTGAAAAACAAAATATTTTCCC
AGGTATCTTTTTACACACTAATGAAGCTCGTTTTGTTCGTCCTGTTAAGCACTTGAAATT
AAATGCCTTAGAATGGATTACTCCTTTCGAATAAGTCCATCTTTCTATTGCTTGCATTGA
AGAAGATATTAGAAACGATACTGAATACTAAGAACTCTCACCTTCATACATTCTTTCAAT
TTTACCTTCTTAAATTCCTTTCCTCAATTATAACTAATCCCCTAGAAATATGTATCAGTG
CTAGATGGCTAAGCAAACTATGGGTACTTCTATGCACAATTTCCCTTATCGCTTTGATAA
CAGAATATATAGATTATTAAATGGTTAAATTCCTATGGTTAAAGGTATGGATCCTGAAAG
TTATGGTCTTTCTGATTATCCTTCTGGAACAAATGCTATCGTTGCAGTTATCAGTTATAC
TGGTTATGATATGGAAGACGCTATGATTCTGAATAAATCATCATACGAAAGAGGATTCGG
ACATGGTTGTGTCTATAAAAACTACTCATACGATGTTGCTGAATTAAATAAAGAAAAAAA
TTCTAAATTTAAGATGTTGAATGAAGTTAAAAATATTGACAGTAAATTATCTTAATCTTT
TTTTTAATTAAAATTTATATTTTCTATTTGAAAATTATTTAGAGAGTTAAATCGCTGAAG
GTTTAGAAGGTGATGGTATTCCAGCTATTGGATCAGTAATTAAAAAAGGCACTGCTGTCT
TCTAAATATATGATACTTAAAAAAATGCTATGAAAACTTTCTACCACAAGGACTCAGAAT
TAGGTAGATTAGATGGTATAGCTTTAGTCCATGATGAAAAAACTAAAGAACCAAGAGTTG
AATATAGAATTAGAATTCCCAGAAATCCTATTATTGGTGATAAATTCTCATCTCGTCACG
GTCAAAAAGGTGTTCTTTCTGTCCTTTGGCCTCATATCGATATGCCCTTCACTGAAAGTG
GTATTACTCCTGATGTTATCATTAACCCTCACGCTTTCCCCTCCAGAATGACAATTGGTA
AATTTACTCTTTATTCAAGAAGATTAACTAATTAATTAAATTTTAATAAAAAAGGTATGT
TAATCGAAAGTATGGCAGGTAAATCTGGAGCTCTTAATGGAAATATATTAGAAACTTAAC
CTTTCTAAAATTATTAAGATGATGATATTGTTAATTATTTCGGTAAATAACTTTAATCTC
ATGGTTATAATTATTACGGTAACGAAGTTATGTATAGCGGTACATATGGTTGCATGATGA
AAGTTGATATCTATATGGGTATTGTATACTATCAAAGATTACGTCACATGGTATTTAAAA
TTTTTGTTAAAGATTGTTAATTAATTGTTATTTCTAATAATATATTAAAGGTTTCAGATA
AAGCTTAAGCAAGATCTACTGGTCCCGTTGATATGCTTACTTAACAACCTATTAAAGGTA
ATTATTAAAAAAATATGTCTTCTAGCTTACTTAATTATATACAAAAAAATAAAAAAATAG
GTAGAAAGAGAGGTGGTGGTATTAGAATGGGTGAAATGGAAAGAGATGCTCTTCTTTCTC
ACGGTATCTCCTTCTGTATGCATGATAGATTCTTAAACTGCTCAGATTATTCTGAAGGTT
ATGTTTGTAATAGTTGTGGTTCATTGGTCTCAACATACCTACATACTAATTTAATGAGTG
GTGAGGCTATTGATAGTTTCTATAATTACAATAAGGGTGTTTAAAAGTCAAAACCTAAAT
GCAGAAAGTGCCAAAATGCTGAGTGTTCTAAAGTAGTAATTCCTTTTGTATTAAGATACT
TGACTAACGAGCTTGCTGCTATGAATATCAAGCTTGCCTTTAAGCTTGAATGA