Identifiers and Description

Gene Model Identifier

TTHERM_01016100

Standard Name

RPA12 (RNA polymerase I subunit 12)

Aliases

PreTt02644 | 198.m00064 | 3746.m00328

Description

DNA-dependent RNA polymerase I subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01016100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20171.12.0008734984431652e-95transcription factor S-II (TFI
IS) (137 aa)
DictyBaseDDB_G02782639.997019043202629e-21rpa12 on chromosome: 3 positio
n 579706 to 580766
SGDYJR063W7.997402223525235e-19RPA12 RNA polymerase I subunit
A12.2; contains two zinc bind
ing domains, and the N termina
l domain is responsible for an
choring to the RNA pol I compl
ex
OxytrichaContig1475.1.g540.00000000000001000191320216021Transcription factor S-II (TFI
IS)
WormBaseWBGene000076160.000000000003001226732525078locus:rpoa-12 DNA-directed R
NA polymerase subunit status
:Confirmed UniProt:O17587
protein_id:CAB02739.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01016100(coding)
ATGGAAATAGATATCAAAAATTTAAATACTGCCAGTGAATTCTGCCCCTAGTGCGGTAAC
ATGATAGAAATGCCTCTTTATTCTGATAAAGTAGAATGTTCAAAGTGTGAATTCTTATGT
TCAGTCCTAGAATATAAGTGCGCTCCTATTGTTTCTAGAATTGAATTTAACTAGAAAAAG
TAATGGCTTGAGTAATATAGAGCCTCATAAAACAAAAAAATACATGGTATAGAAGAAGAA
GATTTGGAAGACAAGCACAAACACAAAAAGGCAACTTTAAAGCAAGAATGTCCTGATTGC
GGTCATGATACTCTTTACTTCTGGACAGTATAAACTCGTTCTGCTGATGAAGGTTCAACA
GTTTTCTACGAATGCTAAGATTGCAAGTTTAAGTTCACTGCAAACAACTGA


>TTHERM_01016100(protein)
MEIDIKNLNTASEFCPQCGNMIEMPLYSDKVECSKCEFLCSVLEYKCAPIVSRIEFNQKK
QWLEQYRASQNKKIHGIEEEDLEDKHKHKKATLKQECPDCGHDTLYFWTVQTRSADEGST
VFYECQDCKFKFTANN


>TTHERM_01016100(gene)
ATGGAAATAGATATCAAAAATTTAAATACTGCCAGTGAATTCTGCCCCTAGTGCGGTAAC
ATGATAGAAATGCCTCTTTATTCTGATAAAGTAGAATGTTCAAAGTGTGAATTCTTATGT
TCAGTCCTAGAATATAAGTGCGCTCCTATTGTTTCTAGAATTGAATTTAACTAGAAAAAG
TAATGGCTTGAGTAATATAGAGCCTCATAAAACAAAAAAATACATGGTATAGAAGAAGAA
GATTTGGAAGACAAGCACAAACACAAAAAGGCAACTTTAAAGCAAGAATGTCCTGATTGC
GGTCATGATACTCTTTACTTCTGGACAGTATAAACTCGTTCTGCTGATGAAGGTTCAACA
GTTTTCTACGAATGCTAAGATTGCAAGTTTAAGTTCACTGCAAACAACTGA