Identifiers and Description

Gene Model Identifier

TTHERM_00047550

Standard Name

RPA1 (RNA Polymerase I largest subunit)

Aliases

PreTt11234 | 3.m01913 | RPII | 3824.m02992

Description

shared largest subunit of RNA Polymerase I

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00047550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_92780
WormBaseWBGene000129999.997093137033517e-262locus:rpoa-1 DNA-directed RN
A polymerase status:Partiall
y_confirmed UniProt:G5ED21
protein_id:CAB07687.2
Tetrahymena borealisEI9_01697.19.997093137033517e-262RNA polymerase Rpb1, domain 2
family protein (1722 aa)
DictyBaseDDB_G02757599.997093137033517e-262rpa1 on chromosome: 2 position
5808489 to 5813651
OxytrichaContig17704.0.g329.997093137033517e-262RNA polymerase Rpb1, domain 5
SGDYOR341W9.997093137033517e-262RPA190 RNA polymerase I larges
t subunit A190

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15470252: Mochizuki K, Gorovsky MA (2004) RNA polymerase II localizes in Tetrahymena thermophila meiotic micronuclei when micronuclear transcription associated with genome rearrangement occurs. Eukaryotic cell 3(5):1233-40
  2. Ref:8756729: Shen X, Gorovsky MA (1996) Linker histone H1 regulates specific gene expression but not global transcription in vivo. Cell 86(3):475-83

Sequences

>TTHERM_00047550(coding)
ATGAATGCTCATTGTGTGCAAAATTAATTTAGAGTATAAAAAATAGAATCAAAAAAAGAA
GCAATAAAAGAAAGAAATAAATAAGATAAATTAAAAGATAAAAAATAAAAATAAAAGGAA
TTATTATTATATACTTATAGATATTAAATGAGTAATAGTTTAGGCTAATTCCAAGAGGTC
ATTAGTAGACGTCTCGCTGGTGTAGGCTTTTCTTATTACACTGCTGACGAAATCCGTAAA
TTGTCAGTAAAGGAAATAACTAATCCTATTGCATTCGACTCATTAAATAGACCTATCAAA
GGTGGTTTATATGATCCTTGTATGGGTGTATCTCCTTACGATAAATTTACTCGTTGCGAA
ACTTGTGGTTGTGAAGGATTGGAATGTCCTGGTCATATGGGTCACGTAGAACTCCTCTTA
CCTGTTTATAACCCTTTCTTAATTGATAAGTTGCTCAAGTTATTAAGAGCCTAGTGTTTA
AAATGCAATAAGTTTAGAATGACAAATTAAAAACTCAAGATGTTTGCTAATGTTTTTACT
CTTATTAAGCTTGGTTACATCTTCGAAGCTAAAGAATATAAATAAACATGTGAAAGTTTG
AGTATCCTTTAAATTTAAAATAATAAAGAAACAACTCAAATATAGTCATATGCTGACAAG
CGTCGTAAATCTAGTGATTACAAGTCATCTGACACTGAATAAATAATGCCTAAGAAGTCT
TAAATTGAATAGGAAGGAGCTAAGATTTATTAGAATAATATTAACAACCTTGAAGATAAA
AAGAAGCAATTGCTCTCTTTAATTAATGTTAAGCAAAATAATACAGAATAGTTTTCAAAG
GGTGTTTCTTACACAAATGCCATGAACAGTGCATTTGAATAAGCCCTCAAAGAATTTTGG
AATAGCATAAATATTGGCAAATGCCCTCACTGCAAAGAACCATAATAAGCAATTAGAAAA
GAAGGTTTTTCAAAGTTTTTCATAAAGAAAAGTTCTAGCGAAGCAAAGAAGTCTTCAAGC
CAAAAGAAACACTAAGATGACTACACTTCTGATGATGATCAAAGTGAGTCTGGTCACTCT
AAGGCTGAAAAAGCTAATGCTAATTAAAAATATCTTGATCCTTTAGAAGTAAAAGAATTA
ATGAGAAGATTTTGGGATGAAGAAAGAAAATTGCTTAACATCATTTACGGTACTATCGAA
GTTACTCCTTAAACTTTAAAAAACTCTTCTAAAGGTTTTATGATAAGAAGAAATGACTAT
AATATGTTCTTTATTGAAGTTATTCCAGTAACTCCCAATAGATTTAGACCTGAAAATAAG
CTTGGAGAATAAACATTCTTGCATGGACATACTGTAGTTTTGACAAAAATTTTATAATTC
AATGTTGAATTAAGACGTATGATTGTCTTGCAAAGACAAAGTTTAAGCGAAGAAAAGAAA
AAGAAATTAATAGATTAGCTTGATTCTCGCTTTTAAAATTAATTATAATTAAAGCAAAAC
TAGAATTTCTAGCAAACTATTAACAATATTGTTAAGCTTAATGATGTCATCACTAAGTGG
TTAGATATACAAGAAGCTGTTAACTGCTTTTTAGATTCTTCTAAGGCTACTAAGACTTAA
GATCGTGAAGGTACAGGTATTCGTTAACTCCTTGAAAAGAAGGAAGGTCTCTTTAGAATG
AAAATGATGGGTAAGCGTGTTAACTACGCAGCTAGATCAGTTATTTCTCCTGATCCTAAT
TTAAACACTAATGAAGTCGGTGTTCCACTTTTTGTTGCAAAAAAACTTACTTTCCCTGAA
TATGTAAATGAATATAATGCTAAGCATCTCAGAAAACTTATTATCAATGGTCCTTTCTAA
CATCCTGGTGCAAATTTCATTGTTGAAAACGGAAACAAGATTTCCCTTGAAGCTCTCAAT
GAGCAATAAAGAATAGGTCTTGCTAAGACTCTTTTAAATAACTCTAAAAATAAAGTTGTC
TATCGTCATTTATAATCTGGTGATGTCCTCCTTTTCAATAGACAACCTACCCTACATAAA
GCTTCATTGATGAGTCATATAGCTAGAGTACTTCCCAGAGAATAAACTATTAGAATGCAC
TATGCAAACTGTAAATCATATAATGCAGATTTCGATGGTGATGAAATGAACTTGCATTTC
CTTTAATCTCATTTAGCCAGAGCTGAAGGTTATCACATTAGTTTAAATGATCGTTAATTC
ATTAACACCACTAACGGTAATCCTTTGAGAGAATTGATTCAAGATACTATTGTTTCAGCT
GTATTCTTGACTCATAAGGAAAAATTCTTACAAAAAGAAGAATTCTAAGAGCTTGTCTAC
GCTGCTACTTGGAACATGTTTGAAAAGAATAATAATTCTACCACAAAGCCTTATAAGATT
TTCTTAGTTCCTCCTGCTATTCAAAAACCCAAACCTTTGTGGACTGGTAAACAACTCATC
ACAAACATCATCAAGATTGTAGTCTAATAGAATCAAAAGAAAGATTATGAATAAGGTGTC
TATATGGAAATGAAGGCAAAGCTTACTGCTGACGAATTGACTGGTATTTATAAGGACGAT
ACAGTTGTCATAATCAGAGATAATGAACTTCTTTAGGGTGTTTTGGATAAAAACTAATTT
GGTGCTGGTGCCACTTATGGTCTTATGCACGCTTTTTATGAATTATATGGAGCATCTCTA
ACAGGTAAGCTTTTCACTGCTCTTGCTAAATTACTCAGTGCCCATCTCTAAATGCATGGT
TTTACTTGCGGTATGGATGATCTTCTTGTCAGCAAAGAGAGTGATGAATAACGTCTTCAA
GAAATCAAGGCTGCACACGTTGATGGTGTCCTTGCATGTGCTGAATTCGTTGGTATGAAA
GACTATGAAGTTCCTTAAGGCTGGAATTTATATAACAGACCTAATTTTGTTCTCAACAGC
AAAGGTAGATTCTCTTCTAATGTTCTTAAACGTAAGCCCGAAGTTGACTATCTTTCAAAT
GAAAATCCCATTCTTGAGTAAATTCAAAGAAAGCTCGTTCGTGATCCCCAACTTGCTGAA
GCTTAAGATAATGTTTATAAGTCAACTATGTCTTAAAAAGGTTCCAAAATTCTTAACACT
GCTCTCGGTGGTCTTATTAAAAAATTCCCTTTCAACAATTTCACTACAATGACTAATTCT
GGTGCTAAGGGTTCTAAAGTCAACCATACGTAAGTTTCTGCCTTACTTGGTCAATAAGAA
TTAGAAGGTCGTAGAGTTCCCGTTATGGCTACTGGTCGTACTCTTCCTTGCTTCTTACCA
TATGATCCCAACCCAAGAGCTGGTGGTTTTATTAGTGATCGTTTCTTGAGTGGTCTTAGA
CCTGCTGAATTCTTCTTCCATTGTATGGCTGGTAGAGAAGGTTTGATTGATACTGCTGTC
AAAACAAGTAGATCCGGATATCTCCAAAGATGCTTAATGAAGCACTTAGAAGCACTTAAA
GTTGCATATGACTACACTGTCAGAGATGCTGATGGCTCAGTTGTCCAATTCTATTATGGT
GAAGACTCTATTGATCCCAATAAAGTTAAATATTTAGAAAAATTCCGTTTCTTAGCTGAA
AACTTTACTTCTTTCACTCAAAAATATGATCCTTATCACTTGAAAGACTCTCATGATTTC
GAATCTGTCAATCGTTTCTTGAAGAAAAGAAAGAGATAAGAAAGTTCTGAAACAGAAAAG
AAAACTTGTGACACTATTATGAACAACTTTTTACCTGGTAAACACATTGGCTCTGTTTCT
GAACGTGTCTACAAGAATGTAAAGGAATACATTAAGAAAGAATAGCAAAGTGCTGATCCT
TACAGCAACATCTTCAACATAAAGTAGGATTAATTAAGTCCTTAAAAATTCCATATGCTT
TTCAATGTAAAATACCTTAACTCTCTCATTCATCCTGGTGATTCTGTTGGTTGTCTTGCA
GCCCAAGCTATCGGTGAACCATCTACATAGATGACATTGAATACTTTCCACTTGGCTGGT
CACGGTGGTGTTAACCTTACCTTGGGTATTCCTCGTCTAAGAGAAATCTTGATGACTGCT
ACAGACAAATTGAAGACTCCAGTCATGCTTTTAAATCTTTCAAATCCTGAAGTTGCTTAA
AACAAAGAATAAGTTCAAAATCATGCTCGTAAGCTCTAAAAAATTAATTTATTAGAACTT
GTTAATAACATCGAAGTCAAGGAACAAAAAATTATTGTTGTTGATAACAATATTTTACCC
TTCAATGAACGTTTCAGACACTATGAAATTAAAATCAACTTAGAAGACTTAGAAGCTATT
CACTTCGCATTCTAATTAAACATTGACACAATTAATCGTAGAATTGAAAAGGTCTTCCTT
CCTAACCTCTTCTAATACATTAACAAAGAACTTAAACGTGATTAAAAATCTGAACTTTAA
ACTAGAGTTCTTAAGAAGAAAGAAAATGAAAGCAGCGGTATGGAAACTGAAGGCTTAGTT
AGCGATTTCGACAAAGAAGCTGCTTCAGATGGTGAAGAATTAAAGAAAGCTGCTGATGCT
TTAGTAAGCGAAGTAGAATATGGCATATTTACTGAGACAGAAGATGAATTAAAATCTAAG
TCCAAACCTCAATCTGCAGAACCAGTAAAGAGAGTCCCAACTAGAACTTCCAAAGCAGAA
TTATTTGAAGCTTCTCCTTATTACAACGGTCATACTATAGAAGGTGAACGTATAGTTTGT
AACATTAAATTACCTTTAGATTCTAAGAAGTTATTGATGGTCAACTTGGTTGAAAAAATA
TTAAAGAAGACTTTGGTTTATGAAGTAAAGAATATCTCTAATGCAACTGTCCTCAAAAAG
GATAATAAAGGAGCCACTTCTTATCAAATTTAAACAGAAGGTGTTAATTTCAAGTAAATC
TGGAAAATGGATCACTTCGACTCTAATACTATAGACTCAAATGATATAGCTGCCTTAAAC
AAATGTTACGGTATTGAAGCTGCTAGAAATGCAATTGTAAAAGAAATCGTCACTGTGTTC
GGTGTTTATGGTGTCGTTGTTGATTACAGACACTTGTACTTAATTGCTGATTATCTTACT
TTCAGCGGAGAAATGAAGGCCATGAATAGAGTTTGGATGGATGAAAGCATCAGTCCTTTC
CTCAAGATGTCTTTCGAAACTTGTGTTAAATTCCTTACAAATGCTGCTACAAATAATGAA
ATCGATACTCTTTCTACTCCTTCTTCCTCAATTGTCTTAGGTAGAGTTCCCTAAGTAGGT
ACTGGTGTTTTCGACATTCTCCATAAGGTTTGA


>TTHERM_00047550(protein)
MNAHCVQNQFRVQKIESKKEAIKERNKQDKLKDKKQKQKELLLYTYRYQMSNSLGQFQEV
ISRRLAGVGFSYYTADEIRKLSVKEITNPIAFDSLNRPIKGGLYDPCMGVSPYDKFTRCE
TCGCEGLECPGHMGHVELLLPVYNPFLIDKLLKLLRAQCLKCNKFRMTNQKLKMFANVFT
LIKLGYIFEAKEYKQTCESLSILQIQNNKETTQIQSYADKRRKSSDYKSSDTEQIMPKKS
QIEQEGAKIYQNNINNLEDKKKQLLSLINVKQNNTEQFSKGVSYTNAMNSAFEQALKEFW
NSINIGKCPHCKEPQQAIRKEGFSKFFIKKSSSEAKKSSSQKKHQDDYTSDDDQSESGHS
KAEKANANQKYLDPLEVKELMRRFWDEERKLLNIIYGTIEVTPQTLKNSSKGFMIRRNDY
NMFFIEVIPVTPNRFRPENKLGEQTFLHGHTVVLTKILQFNVELRRMIVLQRQSLSEEKK
KKLIDQLDSRFQNQLQLKQNQNFQQTINNIVKLNDVITKWLDIQEAVNCFLDSSKATKTQ
DREGTGIRQLLEKKEGLFRMKMMGKRVNYAARSVISPDPNLNTNEVGVPLFVAKKLTFPE
YVNEYNAKHLRKLIINGPFQHPGANFIVENGNKISLEALNEQQRIGLAKTLLNNSKNKVV
YRHLQSGDVLLFNRQPTLHKASLMSHIARVLPREQTIRMHYANCKSYNADFDGDEMNLHF
LQSHLARAEGYHISLNDRQFINTTNGNPLRELIQDTIVSAVFLTHKEKFLQKEEFQELVY
AATWNMFEKNNNSTTKPYKIFLVPPAIQKPKPLWTGKQLITNIIKIVVQQNQKKDYEQGV
YMEMKAKLTADELTGIYKDDTVVIIRDNELLQGVLDKNQFGAGATYGLMHAFYELYGASL
TGKLFTALAKLLSAHLQMHGFTCGMDDLLVSKESDEQRLQEIKAAHVDGVLACAEFVGMK
DYEVPQGWNLYNRPNFVLNSKGRFSSNVLKRKPEVDYLSNENPILEQIQRKLVRDPQLAE
AQDNVYKSTMSQKGSKILNTALGGLIKKFPFNNFTTMTNSGAKGSKVNHTQVSALLGQQE
LEGRRVPVMATGRTLPCFLPYDPNPRAGGFISDRFLSGLRPAEFFFHCMAGREGLIDTAV
KTSRSGYLQRCLMKHLEALKVAYDYTVRDADGSVVQFYYGEDSIDPNKVKYLEKFRFLAE
NFTSFTQKYDPYHLKDSHDFESVNRFLKKRKRQESSETEKKTCDTIMNNFLPGKHIGSVS
ERVYKNVKEYIKKEQQSADPYSNIFNIKQDQLSPQKFHMLFNVKYLNSLIHPGDSVGCLA
AQAIGEPSTQMTLNTFHLAGHGGVNLTLGIPRLREILMTATDKLKTPVMLLNLSNPEVAQ
NKEQVQNHARKLQKINLLELVNNIEVKEQKIIVVDNNILPFNERFRHYEIKINLEDLEAI
HFAFQLNIDTINRRIEKVFLPNLFQYINKELKRDQKSELQTRVLKKKENESSGMETEGLV
SDFDKEAASDGEELKKAADALVSEVEYGIFTETEDELKSKSKPQSAEPVKRVPTRTSKAE
LFEASPYYNGHTIEGERIVCNIKLPLDSKKLLMVNLVEKILKKTLVYEVKNISNATVLKK
DNKGATSYQIQTEGVNFKQIWKMDHFDSNTIDSNDIAALNKCYGIEAARNAIVKEIVTVF
GVYGVVVDYRHLYLIADYLTFSGEMKAMNRVWMDESISPFLKMSFETCVKFLTNAATNNE
IDTLSTPSSSIVLGRVPQVGTGVFDILHKV


>TTHERM_00047550(gene)
GATAATTAATAGGAATTTAAGATAATCAAAGCCATTTATGACAGTATCTGAAATGAGTAA
TGAATGCTCATTGTGTGCAAAATTAATTTAGAGTATAAAAAATAGAATCAAAAAAAGAAG
CAATAAAAGAAAGAAATAAATAAGATAAATTAAAAGATAAAAAATAAAAATAAAAGGAAT
TATTATTATATACTTATAGATATTAAATGAGTAATAGTTTAGGCTAATTCCAAGAGGTCA
TTAGTAGACGTCTCGCTGGTGTAGGCTTTTCTTATTACACTGCTGACGAAATCCGTAAAT
TGTCAGTAAAGGAAATAACTAATCCTATTGCATTCGACTCATTAAATAGACCTATCAAAG
GTAATAAATCGATTTTTCATAATTTATAAAATTCCTTTTCATGATTTCATAATGCTACTT
TGATTATTTAAAGATTGTAGTTATGGAATCTTTTAAAACTTTGATATTTTTTTTCCCAAA
TTTATTACAATACTCAAAGCATTATATAATGAAATATATTTTAATAAACAAAGGTGGTTT
ATATGATCCTTGTATGGGTGTATCTCCTTACGATAAATTTACTCGTTGCGAAACTTGTGG
TTGTGAAGGATTGGAATGTCCTGGTATAAATTTATTAATAAATTTTGATTTATCCATTGA
ATTTCATGAAGCTGATATCTTGCATTTTTGGTTAATCATTAAGTTGATAAGCATTAAGAA
AAATTTACGGATTTCATGAATTTTCAATATAACTTTGAAAAATTTTACTCAATCGTTTTA
TTTCTACATTAAATAAAATAGGTCATATGGGTCACGTAGAACTCCTCTTACCTGTTTATA
ACCCTTTCTTAATTGATAAGTTGCTCAAGTTATTAAGGTATACCTCTATTCAATAAAATA
AATTAAATATAAGAAACAAAACATTTTAGCTCGATCTTGTAAATCTTTAAATCAAAAAAT
AAAGAAGTTTTAAGCCAACAAAATAATTAAACAGAGTTTTAAAAAATTTAAAAGCTAAAT
AAGAGGATTAGTTAGTTAGTTACAAATAAACATTCAATATAATAGCAATCTTAACATATA
TTAGACTAATAAATTTAACATTTTAAAAGTATATTTATTAGTCTACTTATTAAACATAAA
AATGTTTAGATACATTGTTACAAATTACTATTTAAGAAATAAAAAGATTTCAATAAATAG
ATTAGAGCATAAATTTGTCTATTTTTGCATTATTTCTAAAACAAGTAATTAAAATAATTA
TAAATTTATTTAAATAGAGCCTAGTGTTTAAAATGCAATAAGTTTAGAATGACAAATTAA
AAACTCAAGATGTTTGCTAATGTTTTTACTCTTATTAAGCTTGGTTACATCTTCGAAGCT
AAAGAATATAAATAAACATGTGAAAGTTTGAGTATCCTTTAAATTTAAAATAATAAAGAA
ACAACTCAAATATAGTCATATGCTGACAAGCGTCGTAAATCTAGTGATTACAAGTCATCT
GACACTGAATAAATAATGCCTAAGAAGTCTTAAATTGAATAGGAAGGAGCTAAGATTTAT
TAGAATAATATTAACAACCTTGAAGATAAAAAGAAGCAATTGCTCTCTTTAATTAATGTT
AAGCAAAATAATACAGAATAGTTTTCAAAGGGTGTTTCTTACACAAATGCCATGAACAGT
GCATTTGAATAAGCCCTCAAAGAATTTTGGAATAGCATAAATATTGGCAAATGCCCTCAC
TGCAAAGAACCATAATAAGCAATTAGAAAAGAAGGTTTTTCAAAGTTTTTCATAAAGAAA
AGTTCTAGCGAAGCAAAGAAGTCTTCAAGCCAAAAGAAACACTAAGATGACTACACTTCT
GATGATGATCAAAGTGAGTCTGGTCACTCTAAGGCTGAAAAAGCTAATGCTAATTAAAAA
TATCTTGATCCTTTAGAAGTAAAAGAATTAATGAGAAGATTTTGGGATGAAGAAAGAAAA
TTGCTTAACATCATTTACGGTACTATCGAAGTTACTCCTTAAACTTTAAAAAACTCTTCT
AAAGGTATTTATTTATTTGTTAATATATTTTTTTTCTAGAAAATAATAACTAATTTATTT
TAATTTAATAGGTTTTATGATAAGAAGAAATGACTATAATATGTTCTTTATTGAAGTTAT
TCCAGTAACTCCCAATAGATTTAGACCTGAAAATAAGCTTGGAGAATAAACATTCTTGCA
TGGACATACTGTAGTTTTGACAAAAATTTTATAATTCAATGTTGAATTAAGACGTATGAT
TGTCTTGCAAAGACAAAGTTTAAGCGAAGAAAAGAAAAAGAAATTAATAGATTAGCTTGA
TTCTCGCTTTTAAAATTAATTATAATTAAAGCAAAACTAGAATTTCTAGCAAACTATTAA
CAATATTGTTAAGCTTAATGATGTCATCACTAAGTGGTTAGATATACAAGAAGCTGTTAA
CTGCTTTTTAGATTCTTCTAAGGCTACTAAGACTTAAGATCGTGAAGGTACAGGTATTCG
TTAACTCCTTGAAAAGAAGGAAGGTCTCTTTAGAATGAAAATGATGGGTAAGCGTGTTAA
CTACGCAGCTAGATCAGTTATTTCTCCTGATCCTAATTTAAACACTAATGAAGTCGGTGT
TCCACTTTTTGTTGCAAAAAAACTTACTTTCCCTGAATATGTAAATGAATATAATGCTAA
GCATCTCAGAAAACTTATTATCAATGGTCCTTTCTAACATCCTGGTGCAAATTTCATTGT
TGAAAACGGAAACAAGATTTCCCTTGAAGCTCTCAATGAGCAATAAAGAATAGGTCTTGC
TAAGACTCTTTTAAATAACTCTAAAAATAAAGTTGTCTATCGTCATTTATAATCTGGTGA
TGTCCTCCTTTTCAATAGACAAGTAATTTTTAACAAATTTATTTTTTAACTCAAACTTTT
ACTTTTGTTGTTGTTTTTTTTTTAAGAGTAAGCTTATTTTATTTTTAAACTATAATAGCC
TACCCTACATAAAGCTTCATTGATGAGTCATATAGCTAGAGTACTTCCCAGAGAATAAAC
TATTAGAATGCACTATGCAAACTGTAAATCATATAATGCAGATTTCGATGGTGATGAAAT
GAACTTGCATTTCCTTTAATCTCATTTAGCCAGAGCTGAAGGTTATCACATTAGTTTAAA
TGATCGTTAATTCATTAACACCACTAACGGTAATCCTTTGAGAGAATTGATTCAAGATAC
TATTGTTTCAGCTGTATTCTTGACTCATAAGGAAAAATTCTTACAAAAAGAAGAATTCTA
AGAGCTTGTCTACGCTGCTACTTGGAACATGTTTGAAAAGAATAATAATTCTACCACAAA
GCCTTATAAGATTTTCTTAGTTCCTCCTGCTATTCAAAAACCCAAACCTTTGTGGACTGG
TAAACAACTCATCACAAACATCATCAAGATTGTAGTCTAATAGAATCAAAAGAAAGATTA
TGAATAAGGTGTCTATATGGAAATGAAGGCAAAGCTTACTGCTGACGAATTGACTGGTAT
TTATAAGGACGATACAGTTGTCATAATCAGAGATAATGAACTTCTTTAGGGTGTTTTGGA
TAAAAACTAATTTGGTGCTGGTGCCACTTATGGTCTTATGCACGCTTTTTATGAATTATA
TGGAGCATCTCTAACAGGTAAGCTTTTCACTGCTCTTGCTAAATTACTCAGTGCCCATCT
CTAAATGCATGGTTTTACTTGCGGTATGGATGATCTTCTTGTCAGCAAAGAGAGTGATGA
ATAACGTCTTCAAGAAATCAAGGCTGCACACGTTGATGGTGTCCTTGCATGTGCTGAATT
CGTTGGTATGAAAGACTATGAAGTTCCTTAAGGCTGGAATTTATATAACAGACCTAATTT
TGTTCTCAACAGCAAAGGTAGATTCTCTTCTAATGTTCTTAAACGTAAGCCCGAAGTTGA
CTATCTTTCAAATGAAAATCCCATTCTTGAGTAAATTCAAAGAAAGCTCGTTCGTGATCC
CCAACTTGCTGAAGCTTAAGATAATGTTTATAAGTCAACTATGTCTTAAAAAGGTTCCAA
AATTCTTAACACTGCTCTCGGTGGTCTTATTAAAAAATTCCCTTTCAACAATTTCACTAC
AATGACTAATTCTGGTGCTAAGGGTTCTAAAGTCAACCATACGTAAGTTTCTGCCTTACT
TGGTCAATAAGAATTAGAAGGTCGTAGAGTTCCCGTTATGGCTACTGGTCGTACTCTTCC
TTGCTTCTTACCATATGATCCCAACCCAAGAGCTGGTAATAAAAAAATTTATTTACTTGT
TTTATTAATTTAATTAAATATATATTAAAATAAATAGGTGGTTTTATTAGTGATCGTTTC
TTGAGTGGTCTTAGACCTGCTGAATTCTTCTTCCATTGTATGGCTGGTAGAGAAGGTTTG
ATTGATACTGCTGTCAAAACAAGTAGATCCGGATATCTCCAAAGATGCTTAATGAAGCAC
TTAGAAGCACTTAAAGTTGCATATGACTACACTGTCAGAGATGCTGATGGCTCAGTTGTC
CAATTCTATTATGGTGAAGACTCTATTGATCCCAATAAAGTTAAATATTTAGAAAAATTC
CGTTTCTTAGCTGAAAACTTTACTTCTTTCACTCAAAAATATGATCCTTATCACTTGAAA
GACTCTCATGATTTCGAATCTGTCAATCGTTTCTTGAAGAAAAGAAAGAGATAAGAAAGT
TCTGAAACAGAAAAGAAAACTTGTGACACTATTATGAACAACTTTTTACCTGGTAAACAC
ATTGGCTCTGTTTCTGAACGTGTCTACAAGAATGTAAAGGAATACATTAAGAAAGAATAG
CAAAGTGCTGATCCTTACAGCAACATCTTCAACATAAAGTAGGATTAATTAAGTCCTTAA
AAATTCCATATGCTTTTCAATGTAAAATACCTTAACTCTCTCATTCATCCTGGTGATTCT
GTTGGTTGTCTTGCAGCCCAAGCTATCGGTGAACCATCTACATAGATGACATTGAATACT
TTCCACTTGGCTGGTCACGGTGGTGTTAACCTTACCTTGGGTATTCCTCGTCTAAGAGAA
ATCTTGATGACTGCTACAGACAAATTGAAGACTCCAGTCATGCTTTTAAATCTTTCAAAT
CCTGAAGTTGCTTAAAACAAAGAATAAGTTCAAAATCATGCTCGTAAGCTCTAAAAAATT
AATTTATTAGAACTTGTTAATAACATCGAAGTCAAGGAACAAAAAATTATTGTTGTTGAT
AACAATATTTTACCCTTCAATGAACGTTTCAGACACTATGAAATTAAAATCAACTTAGAA
GACTTAGAAGCTATTCACTTCGCATTCTAATTAAACATTGACACAATTAATCGTAGAATT
GAAAAGGTCTTCCTTCCTAACCTCTTCTAATACATTAACAAAGAACTTAAACGTGATTAA
AAATCTGAACTTTAAACTAGAGTTCTTAAGAAGAAAGAAAATGAAAGTAAAATTATTTTA
AATAAATTATTTAAAAATATTAACCTAATTATAATTTAAAAAGGCAGCGGTATGGAAACT
GAAGGCTTAGTTAGCGATTTCGACAAAGAAGCTGCTTCAGATGGTGAAGAATTAAAGAAA
GCTGCTGATGCTTTAGTAAGCGAAGTAGAATATGGCATATTTACTGAGACAGAAGATGAA
TTAAAATCTAAGTCCAAACCTCAATCTGCAGAACCAGTAAAGAGAGTCCCAACTAGAACT
TCCAAAGCAGAATTATTTGAAGCTTCTCCTTATTACAACGTAAGCTATTAATAAATATTC
AAAACCATAAGTAATATCTATATATTAATCAAAAAGGGTCATACTATAGAAGGTGAACGT
ATAGTTTGTAACATTAAATTACCTTTAGATTCTAAGAAGTTATTGATGGTCAAGTAATAA
TTCTTTACTATTTTTTATTTATTTGTGCTTTCTTCAATTTTAAAAAAACACTTATTAATT
CTCATTTTACATAAAATAGCTTGGTTGAAAAAATATTAAAGAAGACTTTGGTTTATGAAG
TAAAGAATATCTCTAATGCAACTGTCCTCAAAAAGGATAATAAAGGAGCCACTTCTTATC
AAATTTAAACAGAAGGTGTTAATTTCAAGTAAATCTGGAAAATGGATCACTTCGACTCTA
ATACTATAGACTCAAATGATATAGCTGCCTTAAACAAATGTTACGGTGTAAGAAATTCAT
TTTTTTTAACAAAAAAATATTTTATTTTGATTATTTACATATTAATTATATTTTAATAAT
TAGATTGAAGCTGCTAGAAATGCAATTGTAAAAGAAATCGTCACTGTGTTCGGTGTTTAT
GGTGTCGTTGTTGATTACAGACACTTGTACTTAATTGCTGATTATCTTACTTTCAGCGGA
GAAATGAAGGCCATGAATAGAGTTTGGATGGATGAAAGCATCAGTCCTTTCCTCAAGATG
TCTTTCGAAACTTGTGTTAAATTCCTTACAAATGCTGCTACAAATAATGAAATCGATACT
CTTTCTACTCCTTCTTCCTCAATTGTCTTAGGTAGAGTTCCCTAAGTAGGTACTGGTGTT
TTCGACATTCTCCATAAGGTTTGAAAGAAATAAATAACTTCCTACTTTTGATAAAATCTA
ATATAAATTTACTTCTATTTATATTAACTCTTTTAAAAATAAATTCAATAATAACTATAT
CTATAAAATCATTAAAACTAATTACTTTATAAGAGTGCATTCAATCATCCATCAAATCTT
AAAGTAAACGAATTAAATACATAAACATTTTAGTTAAATAAATTAAATTGAATAAAACTT
AAATTTAAGTTTCTGTAAAATCCTGCCAAGAGAAAATATAGAAAATAAAAATTTAACAAA
TTCATCAATCAATCCATCCATCCATCTAAATCATTAAGAAAATAATATTTATAATTATTA
TATAAAATTCAACCAGAGTTAATATTTTAAAATTCACACTAAAATAAAAATAAATTATTT
CCAAATTAAACAAAATTAATTGTTTATATACAAAAATATGTTTGTTGTATACCATTTTTA
ATATTCTTTTAATCATTTGCAA