Identifiers and Description

Gene Model Identifier

TTHERM_00142290

Standard Name

RNH2 (RNase H2)

Aliases

PreTt26635 | 11.m00332 | 3702.m00056

Description

ribonuclease HII family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00142290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04848.19.003703520551527e-172ribonuclease HII family protei
n (285 aa)
DictyBaseDDB_G02925846.9991332754409754e-68rnaseh2A on chromosome: 6 posi
tion 1802425 to 1803401
OxytrichaContig14329.0.g313.0000115468388957e-66Ribonuclease HII
WormBaseWBGene000043839.996907204735647e-62locus:rnh-2 Ribonuclease H2
subunit A status:Confirmed
UniProt:Q9U6P6 protein_id:C
AC70103.1
SGDYNL072W2.0006622580855403e-35RNH201 Ribonuclease H2 catalyt
ic subunit, removes RNA primer
s during Okazaki fragment synt
hesis and errant ribonucleotid
es misincorporated during DNA
replication; homolog of RNAse
HI; related to human AGS4 whic
h causes Aicardi-Goutieres syn
drome
Stentor CoeruleusSteCoe_284829.602680054508676e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00142290(coding)
ATGGCAACATTTGAGAATAAAAAGAAAAATTTAGATTGGGTCATGGGTATAGATGAAGCA
GGAAGAGGACCTGTATTGGGACCTATGGTATATGGCTGTTGCGTTTGGCCAATTTAATAT
GAGCCTGAATTAAAATTAGAAGGCTTTAATGATTCAAAATAACTCACAGAATAGAAAAGA
GACTAGCTTTATGCACGTATGGAAGAATTAAAAAACGACAAGCTATATTTTGAAGTAAGA
ATTTTATCAGCAGAATTCTTATCTAACAGAATGTTAGCGAAAAATAGAGATTCTTTAAAT
GAGTTATCATTTAATGCTGCATATAGCTTGATAGATTCAGTAATGAGTTAAGGTTTTAAT
GTGACTTAAGTATTTTTAGACACAGTAGGTAAAGAAGAAACATATCAAGCAAAGCTCTAC
CAAGATTATAAATATACTTATCCATAACTTAAATTTACAGTATCTTCAAAAGCAGATGCT
AAATTTCCAGTTGTTGGAGCAGCATCAATTTGTGCTAAAGTTACAAGAGATCTTTAAATA
ACAAATAATGATATGAGAGAGCCTTTGGATCTATCTAAAGCTACAGGAAGCGGGTATCCA
TCTGATCCAAACACTAAAAAGTGGCTGTAAGAGGTATTTGACCCTGTATTTGGATTTCCA
TCTAATGTTAGATACTCGTGGTCAACAGTAGATAATATTTTTAATGAAAAAAAATTGTAA
GTAAACTTTTTTGATGAAAGTGATAAGAAAGATAAAAATTAAAAAAGCCTTACTTAAATG
GTAAGTTAAAAAAAATCTGAGACTAATGGATATTACTCAAAAAAAATAGGAATAACTAGA
AATTTTGATTTATGA


>TTHERM_00142290(protein)
MATFENKKKNLDWVMGIDEAGRGPVLGPMVYGCCVWPIQYEPELKLEGFNDSKQLTEQKR
DQLYARMEELKNDKLYFEVRILSAEFLSNRMLAKNRDSLNELSFNAAYSLIDSVMSQGFN
VTQVFLDTVGKEETYQAKLYQDYKYTYPQLKFTVSSKADAKFPVVGAASICAKVTRDLQI
TNNDMREPLDLSKATGSGYPSDPNTKKWLQEVFDPVFGFPSNVRYSWSTVDNIFNEKKLQ
VNFFDESDKKDKNQKSLTQMVSQKKSETNGYYSKKIGITRNFDL


>TTHERM_00142290(gene)
ATGGCAACATTTGAGAATAAAAAGAAAAATTTAGATTGGGTCATGGGTATAGATGAAGCA
GGAAGAGGACCTGTATTGGGACCTATGGTATATGGCTGTTGCGTTTGGCCAATTTAATAT
GAGCCTGAATTAAAATTAGAAGGCTTTAATGATTCAAAATAACTCACAGAATAGAAAAGA
GACTAGCTTTATGCACGTATGGAAGAATTAAAAAACGACAAGCTATATTTTGAAGTAAGA
ATTTTATCAGCAGAATTCTTATCTAACAGAATGTTAGCGAAAAATAGAGATTCTTTAAAT
GAGTTATCATTTAATGCTGCATATAGCTTGATAGATTCAGTAATGAGTTAAGGTTTTAAT
GTGACTTAAGTATTTTTAGACACAGTAGGTAAAGAAGAAACATATCAAGCAAAGCTCTAC
CAAGATTATAAATATACTTATCCATAACTTAAATTTACAGTATCTTCAAAAGCAGATGCT
AAATTTCCAGTTGTTGGAGCAGCATCAATTTGTGCTAAAGTTACAAGAGATCTTTAAATA
ACAAATAATGATATGAGAGAGCCTTTGGATCTATCTAAAGCTACAGGAAGCGGGTATCCA
TCTGATCCAAACACTAAAAAGTGGCTGTAAGAGGTATTTGACCCTGTATTTGGATTTCCA
TCTAATGTTAGATACTCGTGGTCAACAGTAGATAATATTTTTAATGAAAAAAAATTGTAA
GTAAACTTTTTTGATGAAAGTGATAAGAAAGATAAAAATTAAAAAAGCCTTACTTAAATG
GTAAGTTAAAAAAAATCTGAGACTAATGGATATTACTCAAAAAAAATAGGAATAACTAGA
AATTTTGATTTATGA