Identifiers and Description

Gene Model Identifier

TTHERM_00283900

Standard Name

RNH13 (RNase H1.3)

Aliases

PreTt04929 | 25.m00393 | 3694.m00176

Description

RNase H family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00283900

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09026.19.997093137033517e-262hypothetical protein (695 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00283900(coding)
ATGTGCTATAAGTGCCTTCCTGATCATAGTCTCCATTCTGAATAGATTGTTTAGCTTGAT
AACTTAAGTGATAAAAAAAACTTGGATTGCCAAGAGAATATCAATAGCTCTATAGACAGC
AACAAAAATAATAAGCAGGGAGTCAGTCCACTTAAGGTAAATAGCGAATTCAATGGATCT
CCTTTTATGTTAAATAATCTAGCTAACTTAAAAATAAACTCCAGCTCATAGGAGCCTTCA
GATTAAAACGTAAAAAGAAGTAGTGTTAAAAATAGTTTTAGCAAAGTAAAAGAATTCAAT
TCAACATCTAACATAGAAGAAGAAATACTTGACTAGGGTCAAATCAAGCAAAAAAAGAAA
AAATCTAGCATTTCTCTTGATAAGCCAGAAAAATAAATACAACTTAACAATAATACACAA
AGTAGAAAATAAGAATTTAGAGATGTGTTTGTAATTAAAGAAGAAAATATGGATGATGAT
TATACAAACTGTAAAATTGAGAATGGTGGTAATTCTCATTTGAAAAACACTAATGCTTTA
CCTCAAAATGGAAAGAAATATTCTAAAGAGTCTGCTCAAACTAAAGTTTTTGGGACAGAT
ATGTTGTCACAAATTTCCAGACAAAAAGGTAGTAGTTCCTAAAAAAACATAAATCAGTTA
CTAAGTTAAGCTTCCACAGTATCTCCAAGCATCTAACCTGTTGAGAAGAGTATGATGGAT
GTGATTTCTAATACAACTAATTATTATCCATAATATCCCTTCTATCCTCCTCATAATCCT
TATGAAAATCCTTTCTAATTTAGCACTAATTTTAATCCAGGCCACTAAATGACTTATCCT
CATCCACATCCTTAAGGGTACCCACCAAATTAGGTAAATGCGCCTTTTTCTCACCTCTAT
AACCAGTAACATAATTTTAACAATATGCCTCCTTACTATCCTCCTACTCGTTCTTCTTAT
ATGCCAAGCTTTAACCATAATTATTAGTAGAACCACATGCTTTAAGAGTAAGAAACTAAA
GAATAATATCATACTATATCTGATTCCAGTTCTAGTGATAAATATTTTTCAAAAAAAGAT
AAATTAAGTAATGAAAGAAGTCTCTAAAGAAATTAAATGAAAAATGACAAAATAGATTTT
GTTTCATCTGATGAATCTTTGCAATAATAAGAATAGACAGCTACAGACTTTTTTTAAAAT
GGAGCTCTCTCTGAGTTGATTAAGCAAAACGAAAACATTCAAAAGATATGTGTTTATCTT
AGAACTTTAAATGACATTAAAATGTCAGTATGCACTAAAATTGAGGCCATGAAGAATAAA
TTCCTACAACAAATATAAATGAAAGAATAAGATTTCAGTTATGCATTTTTGGCAAATACT
TTCAACCAAAATAATAACTAAGTAGAAGAAAACTTAAAGAGCTACTTTGCAAAAATACAG
CAACTAAATTCCTTTTTTGAAAAGAATTAACTAAGCTACAACCCTTAAGCTGCTAGCAAA
TAGAAACTAAGCTAGATTGAATAAGAACTTGATAGAATGCTTTTTTTTACTATTGAGAAA
ATAGATTAGGAAACTTTAAATTAAACTAAACTAATCAAGTAAGAACATATTGACCCTTTC
AAAGATAATTCAGAGTATGAAGAATTAACATAATTTTATCAAAACTAACCTGCTAATATT
GATGCAATCAAAGACAAAATAAACTTTTATTCTTAGTGTTAGCTCGAATTTGATGGAACA
TCAAAAGGAAACCCTGGAAGATCTGGAGCTGGCTTTATCATCAAAGATTTATACACTGAG
AATAAATTACTTGAGTATTCAGTAGAAGTAGGAACAAAAACTATCAATTAATCTGAGTAT
CTAGCTTTAATCTATGGAATGTATACTTGCTATAAGCTAGGTATTAAGCAGCTTACAATT
TAAGGTGACTCTGAAGTTGTGATAAAACACATGTTAGGTGTTTACTAATGCAGAAGCTAA
CAGCTCAGAGAATACTATAATCTAGCTAAAATTTTAGATGAGCTTTTCCATTTTAAGGAC
TACGTTTAAGTAAAAAAAGAGCTTAACACTGAAGCTGATGCACTAGCCAATCTAGCACTT
AGTTGA


>TTHERM_00283900(protein)
MCYKCLPDHSLHSEQIVQLDNLSDKKNLDCQENINSSIDSNKNNKQGVSPLKVNSEFNGS
PFMLNNLANLKINSSSQEPSDQNVKRSSVKNSFSKVKEFNSTSNIEEEILDQGQIKQKKK
KSSISLDKPEKQIQLNNNTQSRKQEFRDVFVIKEENMDDDYTNCKIENGGNSHLKNTNAL
PQNGKKYSKESAQTKVFGTDMLSQISRQKGSSSQKNINQLLSQASTVSPSIQPVEKSMMD
VISNTTNYYPQYPFYPPHNPYENPFQFSTNFNPGHQMTYPHPHPQGYPPNQVNAPFSHLY
NQQHNFNNMPPYYPPTRSSYMPSFNHNYQQNHMLQEQETKEQYHTISDSSSSDKYFSKKD
KLSNERSLQRNQMKNDKIDFVSSDESLQQQEQTATDFFQNGALSELIKQNENIQKICVYL
RTLNDIKMSVCTKIEAMKNKFLQQIQMKEQDFSYAFLANTFNQNNNQVEENLKSYFAKIQ
QLNSFFEKNQLSYNPQAASKQKLSQIEQELDRMLFFTIEKIDQETLNQTKLIKQEHIDPF
KDNSEYEELTQFYQNQPANIDAIKDKINFYSQCQLEFDGTSKGNPGRSGAGFIIKDLYTE
NKLLEYSVEVGTKTINQSEYLALIYGMYTCYKLGIKQLTIQGDSEVVIKHMLGVYQCRSQ
QLREYYNLAKILDELFHFKDYVQVKKELNTEADALANLALS


>TTHERM_00283900(gene)
ATGTGCTATAAGTGCCTTCCTGATCATAGTCTCCATTCTGAATAGATTGTTTAGCTTGAT
AACTTAAGTGATAAAAAAAACTTGGATTGCCAAGAGAATATCAATAGCTCTATAGACAGC
AACAAAAATAATAAGCAGGGAGTCAGTCCACTTAAGGTAAATAGCGAATTCAATGGATCT
CCTTTTATGTTAAATAATCTAGCTAACTTAAAAATAAACTCCAGCTCATAGGAGCCTTCA
GATTAAAACGTAAAAAGAAGTAGTGTTAAAAATAGTTTTAGCAAAGTAAAAGAATTCAAT
TCAACATCTAACATAGAAGAAGAAATACTTGACTAGGGTCAAATCAAGCAAAAAAAGAAA
AAATCTAGCATTTCTCTTGATAAGCCAGAAAAATAAATACAACTTAACAATAATACACAA
AGTAGAAAATAAGAATTTAGAGATGTGTTTGTAATTAAAGAAGAAAATATGGATGATGAT
TATACAAACTGTAAAATTGAGAATGGTGGTAATTCTCATTTGAAAAACACTAATGCTTTA
CCTCAAAATGGAAAGAAATATTCTAAAGAGTCTGCTCAAACTAAAGTTTTTGGGACAGAT
ATGTTGTCACAAATTTCCAGACAAAAAGGTAGTAGTTCCTAAAAAAACATAAATCAGTTA
CTAAGTTAAGCTTCCACAGTATCTCCAAGCATCTAACCTGTTGAGAAGAGTATGATGGAT
GTGATTTCTAATACAACTAATTATTATCCATAATATCCCTTCTATCCTCCTCATAATCCT
TATGAAAATCCTTTCTAATTTAGCACTAATTTTAATCCAGGCCACTAAATGACTTATCCT
CATCCACATCCTTAAGGGTACCCACCAAATTAGGTAAATGCGCCTTTTTCTCACCTCTAT
AACCAGTAACATAATTTTAACAATATGCCTCCTTACTATCCTCCTACTCGTTCTTCTTAT
ATGCCAAGCTTTAACCATAATTATTAGTAGAACCACATGCTTTAAGAGTAAGAAACTAAA
GAATAATATCATACTATATCTGATTCCAGTTCTAGTGATAAATATTTTTCAAAAAAAGAT
AAATTAAGTAATGAAAGAAGTCTCTAAAGAAATTAAATGAAAAATGACAAAATAGATTTT
GTTTCATCTGATGAATCTTTGCAATAATAAGAATAGACAGCTACAGACTTTTTTTAAAAT
GGAGCTCTCTCTGAGTTGATTAAGCAAAACGAAAACATTCAAAAGATATGTGTTTATCTT
AGAACTTTAAATGACATTAAAATGTCAGTATGCACTAAAATTGAGGCCATGAAGAATAAA
TTCCTACAACAAATATAAATGAAAGAATAAGATTTCAGTTATGCATTTTTGGCAAATACT
TTCAACCAAAATAATAACTAAGTAGAAGAAAACTTAAAGAGCTACTTTGCAAAAATACAG
CAACTAAATTCCTTTTTTGAAAAGAATTAACTAAGCTACAACCCTTAAGCTGCTAGCAAA
TAGAAACTAAGCTAGATTGAATAAGAACTTGATAGAATGCTTTTTTTTACTATTGAGAAA
ATAGATTAGGAAACTTTAAATTAAACTAAACTAATCAAGTAAGAACATATTGACCCTTTC
AAAGATAATTCAGAGTATGAAGAATTAACATAATTTTATCAAAACTAACCTGCTAATATT
GATGCAATCAAAGACAAAATAAACTTTTATTCTTAGTGTTAGCTCGAATTTGATGGAACA
TCAAAAGGAAACCCTGGAAGATCTGGAGCTGGCTTTATCATCAAAGATTTATACACTGAG
AATAAATTACTTGAGTATTCAGTAGAAGTAGGAACAAAAACTATCAATTAATCTGAGTAT
CTAGCTTTAATCTATGGAATGTATACTTGCTATAAGCTAGGTATTAAGCAGCTTACAATT
TAAGGTGACTCTGAAGTTGTGATAAAACACATGTTAGGTGTTTACTAATGCAGAAGCTAA
CAGCTCAGAGAATACTATAATCTAGCTAAAATTTTAGATGAGCTTTTCCATTTTAAGGAC
TACGTTTAAGTAAAAAAAGAGCTTAACACTGAAGCTGATGCACTAGCCAATCTAGCACTT
AGTTGA