Identifiers and Description

Gene Model Identifier

TTHERM_01075590

Standard Name

RNH12 (RNase H1.2)

Aliases

PreTt02671 | 219.m00024

Description

RNase H family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00075 ) ribonuclease HI
  • ( PF07465 ) Photosystem I protein M (PsaM)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01075590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15345.17.002411919958887e-50hypothetical protein (468 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01075590(coding)
ATGAACTCTAAAACAGAAAAATAGAGAATTTGCCCTACTCACAAACTTCAATCTACTTAA
ATATGTTTGAATTTAAAATGTTAGTTAAATAGAATACTTTGCTAAAAATGTATTTAAAAT
CATTAATCACATGCTTCTGATTTGATAGAATTGAAATAATCATAAGAGTTTGAAAATTTA
GATTTAGATTTAAATGGTTAAGTTAAGTAATAAGTTTTGTAAGCTATCTTTAATTAAGCT
AGTAGTTTAGGTAAAATATTTTAGTAAGTAGAATAATTAGAAAATATAAGGAAAAAATTC
AACAAATCGTTGGATAATCTTAAAAAGTAGTACTTTCTATCTTTGAAAATTGATGAGCAA
ATTTTTGAACCTACTTCTATTTTAAATATCATCAACTAGAACTCATATTCATAAGAAGGA
TTAACAAACTATTTTAGTGATATTTAGAAAACTAATTAAATATAATAATATAATATTTAG
GCCTTTTAGGATCAAATTGATTCAGTTGGCAAGTCTATTAATAGTATTGATCAATCAATT
CTAGGATTGGTTAATTCAATTTCAATCTTCTAAACTTAAAGTGCATTAAAAGATGAATAG
ACTAGATTTAATCAAGAAACTAAAAGCCATGCTCAAAATGTTTAATAATAGCAAAAAATT
AGCTAAAACAATATTAAAAATTAACATGAAAACAATCAATAAATAAAAAATCATCAATCT
ATAGACTAAAAAGAAGATCTTTTTGAGAAATAAATACAGTAGAACTAAGTGTTTTCTTAA
TTATTAAATCCTTTACTTTCTTAAAAGATAGACTTTTAAAGTCTATCTAAAAAAGTTGTA
AAATCCCTAGTTTATCGAATAGAATTCGATGGATGTTCTAAAGGCAATCCTGGGTTGGCA
GGTGTTGGATTTTTGATTAAGCAACATGAAAATAATAGCTAAGTGTTAGAATCATTTGCT
GTCAATGTTGGTACTAAAACGAACAATTAATCTGAGTACTTAGCATTAATTTATGGTTTA
TATGTATCCTTAAAAATAGGTATATAAAAGTTATTTATTTAAGGTGACTCTCAGCTTATA
ATATATTAAATGACTGGGAAGTATAACTGTAGTAATGATAATATTAAAAAATATTACGAA
CTTTGCAAGATGCTATAATCTAAATTTTAACAAACATCATTTAACCATGTTTATAGAGAG
TAAAATAAAGAAGCAGATCACCTCTCGAATGTTGCAATAAGCAAATAAAATAAAAACTGA


>TTHERM_01075590(protein)
MNSKTEKQRICPTHKLQSTQICLNLKCQLNRILCQKCIQNHQSHASDLIELKQSQEFENL
DLDLNGQVKQQVLQAIFNQASSLGKIFQQVEQLENIRKKFNKSLDNLKKQYFLSLKIDEQ
IFEPTSILNIINQNSYSQEGLTNYFSDIQKTNQIQQYNIQAFQDQIDSVGKSINSIDQSI
LGLVNSISIFQTQSALKDEQTRFNQETKSHAQNVQQQQKISQNNIKNQHENNQQIKNHQS
IDQKEDLFEKQIQQNQVFSQLLNPLLSQKIDFQSLSKKVVKSLVYRIEFDGCSKGNPGLA
GVGFLIKQHENNSQVLESFAVNVGTKTNNQSEYLALIYGLYVSLKIGIQKLFIQGDSQLI
IYQMTGKYNCSNDNIKKYYELCKMLQSKFQQTSFNHVYREQNKEADHLSNVAISKQNKN


>TTHERM_01075590(gene)
ATTTTAGAATTTATTGAGTTAATTTTAATAAGGATTCAGGTTTATTATAAAAAATATATT
AAGGACTAACAATTTGATATAAAAGAAAATATGAACTCTAAAACAGAAAAATAGAGAATT
TGCCCTACTCACAAACTTCAATCTACTTAAATATGTTTGAATTTAAAATGTTAGTTAAAT
AGAATACTTTGCTAAAAATGTATTTAAAATCATTAATCACATGCTTCTGATTTGATAGAA
TTGAAATAATCATAAGAGTTTGAAAATTTAGATTTAGATTTAAATGGTTAAGTTAAGTAA
TAAGTTTTGTAAGCTATCTTTAATTAAGCTAGTAGTTTAGGTAAAATATTTTAGTAAGTA
GAATAATTAGAAAATATAAGGAAAAAATTCAACAAATCGTTGGATAATCTTAAAAAGTAG
TACTTTCTATCTTTGAAAATTGATGAGCAAATTTTTGAACCTACTTCTATTTTAAATATC
ATCAACTAGAACTCATATTCATAAGAAGGATTAACAAACTATTTTAGTGATATTTAGAAA
ACTAATTAAATATAATAATATAATATTTAGGCCTTTTAGGATCAAATTGATTCAGTTGGC
AAGTCTATTAATAGTATTGATCAATCAATTCTAGGATTGGTTAATTCAATTTCAATCTTC
TAAACTTAAAGTGCATTAAAAGATGAATAGACTAGATTTAATCAAGAAACTAAAAGCCAT
GCTCAAAATGTTTAATAATAGCAAAAAATTAGCTAAAACAATATTAAAAATTAACATGAA
AACAATCAATAAATAAAAAATCATCAATCTATAGACTAAAAAGAAGATCTTTTTGAGAAA
TAAATACAGTAGAACTAAGTGTTTTCTTAATTATTAAATCCTTTACTTTCTTAAAAGATA
GACTTTTAAAGTCTATCTAAAAAAGTTGTAAAATCCCTAGTTTATCGAATAGAATTCGAT
GGATGTTCTAAAGGCAATCCTGGGTTGGCAGGTGTTGGATTTTTGATTAAGCAACATGAA
AATAATAGCTAAGTGTTAGAATCATTTGCTGTCAATGTTGGTACTAAAACGAACAATTAA
TCTGAGTACTTAGCATTAATTTATGGTTTATATGTATCCTTAAAAATAGGTATATAAAAG
TTATTTATTTAAGGTGACTCTCAGCTTATAATATATTAAATGACTGGGAAGTATAACTGT
AGTAATGATAATATTAAAAAATATTACGAACTTTGCAAGATGCTATAATCTAAATTTTAA
CAAACATCATTTAACCATGTTTATAGAGAGTAAAATAAAGAAGCAGATCACCTCTCGAAT
GTTGCAATAAGCAAATAAAATAAAAACTGA