Identifiers and Description

Gene Model Identifier

TTHERM_00535250

Standard Name

RNH11 (RNase H1.1)

Aliases

PreTt03110 | 69.m00152 | 3718.m00014

Description

RNase H family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 21.6%

TetraMine Data

TTHERM_00535250

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11226.12.999784173812224e-165RNase H family protein (291 aa
)
OxytrichaContig17363.0.g630.000008000552149328928Reverse transcriptase-like

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00535250(coding)
ATGAAAACTTAGTTTGTATTTATGATTAAAAATGGACTGCTTGTAAAAAGTGTCCGTTTG
ATCAAAACCCAAAAAACTTTAGATAAATACACCAAGCTATATCCACATCATGAAATTAAA
GCCTTCTAGAGCGAAGATTTAGCCTTATAATTCATAAAAGAAAACAACTATCCAATAGAT
ATGGCCAAACAAAAAGTATACATGAAAGTGCATGATACAAAAGAATAGATTGTAGAGGGA
TCAGAAGTATTAAAGCAATTTAAAAAAGGAAAAATTGATCAGGAAAGCCCTGAATTTAAA
AAAATATAAGAAGATGAAGGCTTATAGTAATTTTTAAAATAAACTAAAAATCTATATAAG
TATTACACCGAAAATGAAACTTTGATATAAAAGGCTGCTTAAAAAATTATTAAAACATCT
CAATACTTTTTATTTTTTGATGGAGCTTCAAAGAATAATCCAGGACCCAGCGGTATCGGG
TTTGCAATATTTGACAACGATTAAAAATTGTATTAATAAGCTATTCACACAGGTTTTAAA
ACAAATAATTAAGCTGAATATTTAGCACTTTTATATGGATTAAAGAGTTCTTTGAGTTTA
GGAATAGAATTTCTGAATGTTTATGGAGATTCTCAACTAATTATAAATTAAATGAACAAT
TTATACAGAGTAAAAGATAGAAATTTAATACTCTATAATGGCGAGTGCAAATAACTAAGA
ACTTAATTCAAACATGTAAACTTTAAGTATATCCCAAGAGAATAAAATTCATTAGCTGAT
AGTTTAGCAAATAAAGGTGTAACGCTCTATAAAAAACCTCCTAGTGAAGAAGGTTAAGAA
CCTAATAATGACCCTGATTCAGTTTGA


>TTHERM_00535250(protein)
MKTQFVFMIKNGLLVKSVRLIKTQKTLDKYTKLYPHHEIKAFQSEDLALQFIKENNYPID
MAKQKVYMKVHDTKEQIVEGSEVLKQFKKGKIDQESPEFKKIQEDEGLQQFLKQTKNLYK
YYTENETLIQKAAQKIIKTSQYFLFFDGASKNNPGPSGIGFAIFDNDQKLYQQAIHTGFK
TNNQAEYLALLYGLKSSLSLGIEFLNVYGDSQLIINQMNNLYRVKDRNLILYNGECKQLR
TQFKHVNFKYIPREQNSLADSLANKGVTLYKKPPSEEGQEPNNDPDSV


>TTHERM_00535250(gene)
ATGAAAACTTAGTTTGTATTTATGATTAAAAATGGACTGCTTGTAAAAAGTGTCCGTTTG
ATCAAAACCCAAAAAACTTTAGATAAATACACCAAGCTATATCCACATCATGAAATTAAA
GCCTTCTAGAGCGAAGATTTAGCCTTATAATTCATAAAAGAAAACAACTATCCAATAGAT
ATGGCCAAACAAAAAGTATACATGAAAGTGCATGATACAAAAGAATAGATTGTAGAGGGA
TCAGAAGTATTAAAGCAATTTAAAAAAGGAAAAATTGATCAGGAAAGCCCTGAATTTAAA
AAAATATAAGAAGATGAAGGCTTATAGTAATTTTTAAAATAAACTAAAAATCTATATAAG
TATTACACCGAAAATGAAACTTTGATATAAAAGGCTGCTTAAAAAATTATTAAAACATCT
CAATACTTTTTATTTTTTGATGGAGCTTCAAAGAATAATCCAGGACCCAGCGGTATCGGG
TTTGCAATATTTGACAACGATTAAAAATTGTATTAATAAGCTATTCACACAGGTTTTAAA
ACAAATAATTAAGCTGAATATTTAGCACTTTTATATGGATTAAAGAGTTCTTTGAGTTTA
GGAATAGAATTTCTGAATGTTTATGGAGATTCTCAACTAATTATAAATTAAATGAACAAT
TTATACAGAGTAAAAGATAGAAATTTAATACTCTATAATGGCGAGTGCAAATAACTAAGA
ACTTAATTCAAACATGTAAACTTTAAGTATATCCCAAGAGAATAAAATTCATTAGCTGAT
AGTTTAGCAAATAAAGGTGTAACGCTCTATAAAAAACCTCCTAGTGAAGAAGGTTAAGAA
CCTAATAATGACCCTGATTCAGTTTGA