Identifiers and Description

Gene Model Identifier

TTHERM_00459400

Standard Name

RLP2 (RPA-Like Protein 2)

Aliases

PreTt20371 | 53.m00273 | 3712.m00131

Description

Putative RPA middle subunit protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00459400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13830.19.001601097193671e-134hypothetical protein (289 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27895115: Upton HE, Chan H, Feigon J, Collins K (2017) Shared Subunits of Tetrahymena Telomerase Holoenzyme and Replication Protein A Have Different Functions in Different Cellular Complexes. The Journal of biological chemistry 292(1):217-228

Sequences

>TTHERM_00459400(coding)
ATGGAACAAGAAATACTCAATTAAAGTCTTCTCAAAAGCCCAAATAGAGCTTCAGATGAA
AGCTCTATGATAGTTATACCACAACAAAAAAAACCAAATGTGTAAAAAAAAAAGTTAAAA
ATAAATGTTTCTTAATCAACAGAAGTATCTTATGGTGGATTGGTTTCACCTGAAGGAGAA
ACCCGTGCTTCATCTATCCACCACTTTGAAAGAGAAAAGAAGTGGAGTCAATCAATAATT
CCTTTGACTTGCTTAATGCTCAATAAAGCTATAGCAAATATTAACTTGAGATTAGAAGTT
GAGGGTTAACCTGTGGAACTTGTAGAATTAGTTGGACATGTGTGTGCTTCGCTTTATGGT
AGAGCATACACCTTGAAGGGAGAATAACCATTTATGGCAATATAAATCAGTGATTTATCT
GGAATTTGCTCAGCTATTCTGTATTAACCTACTAATGATGAAGAAAACTTAGTAGAATAC
TTAAAAAGAACTGAAAATTGGCAGTCAAACCCAGATAAAATGCTTAATGGCACTTATGTA
AAAGTAATAGTTAAACCAAAATATTCAGTGACAGAATCAGTATGGAAAAATAACTGCATA
GCTATAAAAATAATATAAAACGCTAATGAAATAACATAACATAACTTAGATGTAATTAAA
TGCTATTTAGAACGCAAAGATGGACTTATCTAAAAGGTGAAGTCTCCTATATAAAACAAT
CCAATTTACATAAAAGCAAAATAAAGAGAAGAAATGGAAAAAAGGAATAGAATAGAAATA
TCAACATTAAAAGAATCTATTCTTTAAAAGGATATGTAAATAGAGGAGGAACATATACAG
CCAATTTAGTGA


>TTHERM_00459400(protein)
MEQEILNQSLLKSPNRASDESSMIVIPQQKKPNVQKKKLKINVSQSTEVSYGGLVSPEGE
TRASSIHHFEREKKWSQSIIPLTCLMLNKAIANINLRLEVEGQPVELVELVGHVCASLYG
RAYTLKGEQPFMAIQISDLSGICSAILYQPTNDEENLVEYLKRTENWQSNPDKMLNGTYV
KVIVKPKYSVTESVWKNNCIAIKIIQNANEITQHNLDVIKCYLERKDGLIQKVKSPIQNN
PIYIKAKQREEMEKRNRIEISTLKESILQKDMQIEEEHIQPIQ


>TTHERM_00459400(gene)
ATGGAACAAGAAATACTCAATTAAAGTCTTCTCAAAAGCCCAAATAGAGCTTCAGATGAA
AGCTCTATGATAGTTATACCACAACAAAAAAAACCAAATGTGTAAAAAAAAAAGTTAAAA
ATAAATGTTTCTTAATCAACAGAAGTATCTTATGGTGGATTGGTTTCACCTGAAGGAGAA
ACCCGTGCTTCATCTATCCACCACTTTGAAGTATTTTATTTTTAAACAATTTTATCTAAT
ATCTAATAATATCTTGAATTTAAAATTTAGAGAGAAAAGAAGTGGAGTCAATCAATAATT
CCTTTGACTTGCTTAATGCTCAATAAAGCTATAGCAAATATTAACTTGAGATTAGAAGTT
GAGGGTTAACCTGTGGAACTTGTAGAATTAGTTGGACATGTGTGTGCTTCGCTTTATGGT
AGAGCATACACCTTGAAGGGAGAATAACCATTTATGGCAATATAAATCAGTGATTTATCT
GGAATTTGCTCAGCTATTCTGTATTAACCTACTAATGATGAAGAAAACTTAGTAGAATAC
TTAAAAAGAACTGAAAATTGGCAGTAAAATAAATAATTTTTTTATAAGTTTTTAATTAGC
CGAATATAAACAAACAAAAACTTTTCTTAATTAAAGGTCAAACCCAGATAAAATGCTTAA
TGGCACTTATGTAAAAGTAATAGTTAAACCAAAATATTCAGTGACAGAATCAGTATGGAA
AAATAACTGCATAGCTATAAAAATAATATAAAACGCTAATGAAATAACATAACATAACTT
AGATGTAATTAAATGCTATTTAGAACGCAAAGATGGACTTATCTAAAAGGTGAAGTCTCC
TATATAAAACAATCCAATTTACATAAAAGCAAAGTAAAATAATATTTTTTAATTTAAAAT
TATAACCAAAGTTTAATTGTTTTAGATATTTAGTATTTTAAGATAAATAAACATATGCTT
TTTAAATTAAAATCATAAATAATAAATTAATTTTTTTTATTAATTATTCTGTTTAGATAA
AGAGAAGAAATGGAAAAAAGGAATAGAATAGAAATATCAACATTAAAAGAATCTATTCTT
TAAAAGGATATGTAAATAGAGGAGGAACATATACAGCCAATTTAGTGA