Identifiers and Description

Gene Model Identifier

TTHERM_00726370

Standard Name

RLP1 (RPA1-Like Protein 1)

Aliases

PreTt21902 | 117.m00154 | RLP1

Description

replication factor-A protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07288 ) Protein of unknown function (DUF1447)
  • ( PF08646 ) Replication factor-A C terminal domain
  • ( TIGR00617 ) replication factor-a protein 1 (rpa1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00726370

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_21097.19.997093137033517e-262hypothetical protein (496 aa)
SGDYAR007C0.0000029996948234116693RFA1 Subunit of heterotrimeric
Replication Protein A (RPA),
which is a highly conserved si
ngle-stranded DNA binding prot
ein involved in DNA replicatio
n, repair, and recombination

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:20363756: Min B, Collins K (2010) Multiple mechanisms for elongation processivity within the reconstituted tetrahymena telomerase holoenzyme. The Journal of biological chemistry 285(22):16434-43

Sequences

>TTHERM_00726370(coding)
ATGGAGAAATTATAAGAAAAAAAATTAAAAGATGTAAAAATTGGAGCTAGAACATTTATA
GTTACTGCTAAAGTCATTTCTAAGGGATCAATAAAGTATACCTACTAAGACAAATCTTTT
AAAATTGAAATATACGATGGCTCACTTGAGCATAGCACACTCGTATACTTTAATTGCTAA
GATATTGAAAATTATTATGAGCAAATTGAACTTGGTAAAGTTTATAAATTTTCCAGAGCA
ATTATTGCTAAGGATGCATAAAAAAAAGAAGCCAGAAAATGTCTCAAGTACGAAATGTTT
AATTCCTAATATATTTAATTAGTTGAAGATGAAAGTATAAACTTAATCTATGCTGCAGAT
TTTAGCAAATATGAACTAATTAAAATAAATCAAATTTCAGAACAACATTAAACAGACCAT
TTCGATATTTTAGGTGTGGTAATGGAAGAACCATCTAAAGAAAGAGTTAAAGATAGTGAA
GGCAGAGAGTTGGATACAATAAAATTTTTAATAGGCGATGAAACAAGACATACTTTGCAA
GTATCCATCAGAAATGAATATGGACTTAATTTAAATCTAAAAATCTTTGATGTGGTTCTC
ATTAAATCAACTCATGTTAATGTTTATGCCAATCAAAAAAGTGTAGATAGTGGTTCCGGA
ATATTAGTTAATCCAGATATCTAGCAAGCTCTGGACCTTTTATATTCATTTGAAAAAATA
ATCTAAGAAGATGAAGAAGATATCGATTATAAAAAAGATAATTAATTAGACAATTCATTT
TTAACAGATGGTAAAGAAGAATGCAAAAGCAATGAATTAAATAAGTAAAGAGCCTTGAAA
TCAAATAAGAATAAGGAGTTTACATAAATTGGTGAAAATAAAGTATCTCTTCACTTCTAT
GATGTTAAATCTATCAATTATGTAGTACAGTAAGTAGAAGACTAGCTTGAAAGAGTGATA
AGACTTTCCTTAACACATTCTACTTAAGATCCAGCTTTTATTAAGGAATTCACAAAATGT
ATTTATTCAGAAATAGAAGGAGAAATATACTCGGCAGGTATTGAAAAGAAACCTTTTTAT
GTTGCATGTAGTGTTTGCAAGAAAAAAATAGAAAATTATCCTGTAATTTAAAAGTGTTTC
AAAAAGTGTGCAGGAGCTACAATTATAGCTAAGATGGCGACTAACCTTAATATAGCAGAT
GCTACCGGAGCACTTAGTGCTTTGGCATTTAATGAATAGTGTGAAGAAATATTTGGTTTT
GATGCTGAGTTTATGAAAATTCTCTATGAATATAAAAATAGTTAGTATTACCACAAAAAA
GATCCTACTTATAGAGATTTTATTAGATAATCATTTACATAAAAATTTAGGTTCCGTATA
TTATCAGGTGTTCAAGTATACGAAAAAAAATATTAAGCAAAGCACAATATCGTTGGTTGT
ACCAAAATAAGTACTCTTCAAAATATTCAAGAAACAGCTTAATCAATAGAACTTCATTTA
CAAAAAAGAATTTTATGA


>TTHERM_00726370(protein)
MEKLQEKKLKDVKIGARTFIVTAKVISKGSIKYTYQDKSFKIEIYDGSLEHSTLVYFNCQ
DIENYYEQIELGKVYKFSRAIIAKDAQKKEARKCLKYEMFNSQYIQLVEDESINLIYAAD
FSKYELIKINQISEQHQTDHFDILGVVMEEPSKERVKDSEGRELDTIKFLIGDETRHTLQ
VSIRNEYGLNLNLKIFDVVLIKSTHVNVYANQKSVDSGSGILVNPDIQQALDLLYSFEKI
IQEDEEDIDYKKDNQLDNSFLTDGKEECKSNELNKQRALKSNKNKEFTQIGENKVSLHFY
DVKSINYVVQQVEDQLERVIRLSLTHSTQDPAFIKEFTKCIYSEIEGEIYSAGIEKKPFY
VACSVCKKKIENYPVIQKCFKKCAGATIIAKMATNLNIADATGALSALAFNEQCEEIFGF
DAEFMKILYEYKNSQYYHKKDPTYRDFIRQSFTQKFRFRILSGVQVYEKKYQAKHNIVGC
TKISTLQNIQETAQSIELHLQKRIL


>TTHERM_00726370(gene)
ATGGAGAAATTATAAGAAAAAAAATTAAAAGATGTAAAAATTGGAGCTAGAACATTTATA
GTTACTGCTAAAGTCATTTCTAAGGGATCAATAAAGTATACCTACTAAGACAAATCTTTT
AAAATTGAAATATACGATGGCTCACTTGAGCATAGCACACTCGTATACTTTAATTGCTAA
GATATTGAAAATTATTATGAGCAAATTGAACTTGGTAAAGTTTATAAATTTTCCAGAGCA
ATTATTGCTAAGGATGCATAAAAAAAAGAAGCCAGAAAATGTCTCAAGTACGAAATGTTT
AATTCCTAATATATTTAATTAGTTGAAGATGAAAGTATAAACTTAATCTATGCTGCAGAT
TTTAGCAAATATGAACTAATTAAAATAAATCAAATTTCAGAACAACATTAAACAGACCAT
TTCGATATTTTAGGTTAGATGATTTAATTTATTTATTTATTATTTTTGTTTTGTTTGATG
CTTTGTTTAAAGTTTTTACTAATATTTAATAATTTTTACTATAAATCTTAGGTGTGGTAA
TGGAAGAACCATCTAAAGAAAGAGTTAAAGATAGTGAAGGCAGAGAGTTGGATACAATAA
AATTTTTAATAGGCGATGAAACAAGACATACTTTGCAAGTATCCATCAGAAATGAATATG
GACTTAATTTAAATCTAAAAATCTTTGATGTGGTTCTCATTAAATCAACTCATGTTAATG
TTTATGCCAATCAAAAAAGTGTAGATAGTGGTTCCGGAATATTAGTTAATCCAGATATCT
AGCAAGCTCTGGACCTTTTATATTCATTTGAAAAAATAATCTAAGAAGATGAAGAAGATA
TCGATTATAAAAAAGATAATTAATTAGACAATTCATTTTTAACAGATGGTAAAGAAGAAT
GCAAAAGCAATGAATTAAATAAGTAAAGAGCCTTGAAATCAAATAAGAATAAGGAGTTTA
CATAAATTGGTGAAAATAAAGTATCTCTTCACTTCTATGATGTTAAATCTATCAATTATG
TAGTACAGTAAGTAGAAGACTAGCTTGAAAGAGTGATAAGACTTTCCTTAACACATTCTA
CTTAAGATCCAGCTTTTATTAAGGAATTCACAAAATGTATTTATTCAGAAATAGAAGGAG
AAATATACTCGGCAGGTATTGAAAAGAAACCTTTTTATGTTGCATGTAGTGTTTGCAAGA
AAAAAATAGAAAATTATCCTGTAATTTAAAAGTGTTTCAAAAAGTGTGCAGGAGCTACAA
TTATAGCTAAGATGGCGACTAACCTTAATATAGCAGATGCTACCGGAGCACTTAGTGCTT
TGGCATTTAATGAATAGTGTGAAGAAATATTTGGTTTTGATGCTGAGTTTATGAAAATTC
TCTATGAATATAAAAATAGTTAGTATTACCACAAAAAAGATCCTACTTATAGAGATTTTA
TTAGATAATCATTTACATAAAAATTTAGGTTCCGTATATTATCAGGTGTTCAAGTATACG
AAAAAAAATATTAAGCAAAGCACAATATCGTTGGTTGTACCAAAATAAGTACTCTTCAAA
ATATTCAAGAAACAGCTTAATCAATAGAACTTCATTTACAAAAAAGAATTTTATGA