Identifiers and Description

Gene Model Identifier

TTHERM_00850570

Standard Name

RLI1 (RNase L Inhibitor 1)

Aliases

PreTt24959 | 149.m00085 | 3750.m00313

Description

essential iron-sulfur protein required for ribosome biogenesis and translation initiation and termination

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00850570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_278200
WormBaseWBGene000127149.997093137033517e-262locus:abce-1 status:Partiall
y_confirmed UniProt:Q9U2K8
protein_id:CAB54424.1
Tetrahymena borealisEI9_18736.19.997093137033517e-262ABC transporter (599 aa)
DictyBaseDDB_G02904839.997093137033517e-262abcE1 on chromosome: 5 positio
n 4209815 to 4211793
OxytrichaContig1173.0.g639.997093137033517e-262ABC transporter
SGDYDR091C9.997093137033517e-262RLI1 Essential iron-sulfur pro
tein required for ribosome bio
genesis and translation initia
tion and termination; facilita
tes binding of a multifactor c
omplex (MFC) of initiation fac
tors to the small ribosomal su
bunit; predicted ABC family AT
Pase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00850570(coding)
ATGGAAGAGACAAAATTGCGTATTGCTATCGTTAATAAGGATAAGTGCAAACCCAAAAAG
TGTAAACAAGAATGTAAATCTGCTTGCCCTATTAACAAATCAGGCAAATAGTGTGTTATT
GTTACTCCTAGTGATAAGATCAGCAATATTTAGGAATCATTATGTATAGGTTGTAATATG
TGTGTTAAAAAATGTCCTTTATAGGCTATCAAGATTATTAACTTGCCTAAGGATATGTCC
AAGGATTTGGTCCATAGATATGGTCCTAATACCTTCAAGTTACACAGATTACCTACTCCT
CGTGCTGGTTAGGTTTTAGGTTTAGTTGGTACTAACGGTATTGGTAAATCTACAGCTTTG
AAGATTTTAGCAGGTAAAGAAATGCCTAATTTAGGTCGTTTCGATAACCCTCCTGACTGG
AAAGAATTACTTTAATACTTCAGAGGTTCAGAATTATAAGGCTATTTCACTAAGATGCTT
GAACAAGAATTCAAGTCTTCAATTAAGGTTTAATACGTTGATGCTATTCCTAAGCACGTT
AAGGGTGTTGTTGGTGAAATCATCAAGAAAAAAGATACTAAGGGTAACTCTGAAAGATTA
ATATAAGAATTAGAATTATCTCATTTACTTGAAAGAGATATTTCTTAACTTTCTGGTGGT
GAATTATAACGTTTAGCTATTTTGATTGTTTGCATCTAAAATGTTTAGATTTCTATGTTC
GATGAACCTTCTTCTTATTTGGATGTAAAGCAAAGACTTAAAGCTGCCCAAGTTATCAGA
AGTCTTATTGATGAAAAGAATTACATTATTTGTGTTGAACACGATTTATCCGTTTTGGAT
TATCTTTCTGATTTCGTTTGCTGTCTCTATGGTTCTCAAACTGCTTACGGTATTGTTACT
ATGCCATTCTCTGTCCGTGAAGGTATTAACATCTTCCTTGCTGGTTTCATCCCCACAGAA
AATATGCGTTTCCGTGACTACGGTCTCAGTTTTAAGGTTGCTGATAATTTAGAACCTATC
GATTTAAAGAAGATGTCTCACTACACTTATCCTGCTATGGAAAAGCAATAAGGTGCATTC
AAGCTCTCTATCTGCCCTGGTGAGTTCAATCAATCTCAAATCGTCGTACTTTTGGGTGAA
AATGGTACTGGTAAAACTACCTTCATTAAAATGTTAGCTGGTAAAGACCCTGCAGTTAAA
GACAAAATCCCTGAATTAAATGTTTCTTACAAGCCTCAAACTGTCAATCCTTCCTTTGAA
TCCAGTGTACGTGATTTGTTAAACATGAGAATTCCTGGTGTTTACACTCAACCTGCCTTC
GTTTCTGATGTAACCAAGCCTATGCTTCTTGATGATATTATTGATAACTAAGTTCTTGAA
TTGTCAGGTGGTGAATTATAAAGAGTTTGCATTATTTTAGCTTTAGGTAAGCCTGCTGAT
GTTTATTTAATCGATGAACCCTCTGCTTACTTGGATTCTGAATAGAGAATTATTGCTGCT
AAAGTTATTAAGAGATATATTTTAAATAGTAAAAAATCTGCTTTCGTTGTAGAACATGAT
TTCATTATGGCTACTTATCTTGCTGATAGTGTCATTGTTTATGAAGGTACTCCTGGTAAA
GAATGTAAGGCTAACAGTCCTCAAAGTTTAGTAAGTGGTATGAACAGATTCTTAGAAATT
ATGGGTGTCACTTTCAGAAGAGACCCTTCAAACTTCAGACCTAGAATTAATAAAATCGAC
TCAATTTTGGATAGAGAACAAAAGATTGCTGGTAACTATTTCTCCTTAGAAGAGTGA


>TTHERM_00850570(protein)
MEETKLRIAIVNKDKCKPKKCKQECKSACPINKSGKQCVIVTPSDKISNIQESLCIGCNM
CVKKCPLQAIKIINLPKDMSKDLVHRYGPNTFKLHRLPTPRAGQVLGLVGTNGIGKSTAL
KILAGKEMPNLGRFDNPPDWKELLQYFRGSELQGYFTKMLEQEFKSSIKVQYVDAIPKHV
KGVVGEIIKKKDTKGNSERLIQELELSHLLERDISQLSGGELQRLAILIVCIQNVQISMF
DEPSSYLDVKQRLKAAQVIRSLIDEKNYIICVEHDLSVLDYLSDFVCCLYGSQTAYGIVT
MPFSVREGINIFLAGFIPTENMRFRDYGLSFKVADNLEPIDLKKMSHYTYPAMEKQQGAF
KLSICPGEFNQSQIVVLLGENGTGKTTFIKMLAGKDPAVKDKIPELNVSYKPQTVNPSFE
SSVRDLLNMRIPGVYTQPAFVSDVTKPMLLDDIIDNQVLELSGGELQRVCIILALGKPAD
VYLIDEPSAYLDSEQRIIAAKVIKRYILNSKKSAFVVEHDFIMATYLADSVIVYEGTPGK
ECKANSPQSLVSGMNRFLEIMGVTFRRDPSNFRPRINKIDSILDREQKIAGNYFSLEE


>TTHERM_00850570(gene)
ATGGAAGAGACAAAATTGCGTATTGCTATCGTTAATAAGGATAAGTGCAAACCCAAAAAG
TGTAAACAAGAATGTAAATCTGCTTGCCCTATTAACAAATCAGGCAAATAGTGTGTTATT
GTTACTCCTAGTGATAAGATCAGCAATATTTAGGAATCATTATGTATAGGTTGTAATATG
TGTGTTAAAAAATGTCCTTTATAGGCTATCAAGATTATTAACTTGCCTAAGGATATGTCC
AAGGATTTGGTCCATAGATATGGTCCTAATACCTTCAAGTTACACAGATTACCTACTCCT
CGTGCTGGTTAGGTAAATTATTTACTTTAAAACTAATTTTTGTAATTAATTCAGTAAGAA
GTTTTTCTTAACTCTCAGTAATTTTATACTTTCTTCATTAATGTAAAATTAAAACTATCA
GTGCAACTACATCTTTTCAATTTAAGAATGAGGAAGCTTAATTCAAAGAGTAGGATTAAG
CACGTAGTGATAATAAATTAATAGTAAAATAGTAATTAAATTAATTGATTATATTATTGA
AGAGTAAAAATTATAATTTAGTCTAAGAGAGTTATGTGAATATAAAATATCAAACAATTG
CTGAAAAAATAAAAAATAAAATGTAATTTGTATAAAAATATATGTTAACTTTACTTTTAA
TAATAGGTTTTAGGTTTAGTTGGTACTAACGGTATTGGTAAATCTACAGCTTTGAAGATT
TTAGCAGGTAAAGAAATGCCTAATTTAGGTCGTTTCGATAACCCTCCTGACTGGAAAGAA
TTACTTTAATACTTCAGAGGTTCAGAATTATAAGGCTATTTCACTAAGATGCTTGAACAA
GAATTCAAGTAATAACACTTTTAAATTATCTCTTAATAGAATGAATTTATATTAAAGATT
GCGATTGATTTTGATTTTTTAAATGAATAACTGAAATAAAGATTTTAAAAGATACTCACT
CACTCTTTCATTCATTTTTATAATATTTAAATTTATATCTTATTAAATTTAATCAAAACT
CACACATACATAGTTAGCAGAAAATTCATAATTAATTAATTCATTTAACGCCATACATAA
AGATTTAATTGCAAAAAACGAAAAAATAAGTTAAAAATCTTATCAACAAATAAGAGCCAA
CAAAATATTTAAAAATATTTTAAATTGTTAAAATAAAAAATATTTGGTTAGATTTATATA
TTTATTTTTTTATAACTTATAGGTCTTCAATTAAGGTTTAATACGTTGATGCTATTCCTA
AGCACGTTAAGGGTGTTGTTGGTGAAATCATCAAGAAAAAAGATACTAAGGGTAACTCTG
AAAGATTAATATAAGAATTAGAATTATCTCATTTACTTGAAAGAGATATTTCTTAACTTT
CTGGTGGTGAATTATAACGTTTAGCTATTTTGATTGTTTGCATCTAAAATGTTTAGATTT
CTATGTTCGATGAACCTTCTTCTTATTTGGATGTAAAGCAAAGACTTAAAGCTGCCCAAG
TTATCAGAAGTCTTATTGATGAAAAGAATTACATTATTTGTGTTGAACACGATTTATCCG
TTTTGGATTATCTTTCTGATTTCGTTTGCTGTCTCTATGGTTCTCAAACTGCTTACGGTA
TTGTTACTATGCCATTCTCTGTCCGTGAAGGTATTAACATCTTCCTTGCTGGTTTCATCC
CCACAGAAAATATGCGTTTCCGTGACTACGGTCTCAGTTTTAAGGTAAATAATTTAATTT
TTGTTGATAATTGATGTAATTAACAAACAATCATTTTAATTAAATCAGGTTGCTGATAAT
TTAGAACCTATCGATTTAAAGAAGATGTCTCACTACACTTATCCTGCTATGGAAAAGCAA
TAAGGTGCATTCAAGCTCTCTATCTGCCCTGGTGAGTTCAATCAATCTCAAATCGTCGTA
CTTTTGGGTGAAAATGGTACTGGTAAAACTACCTTCATTAAAATGTTAGCTGGTAAAGAC
CCTGCAGTTAAAGACAAAATCCCTGAATTAAATGTTTCTTACAAGCCTCAAACTGTCAAT
CCTTCCTTTGAATCCAGTGTACGTGATTTGTTAAACATGAGAATTCCTGGTGTTTACACT
CAACCTGCCTTCGTTTCTGATGTAACCAAGCCTATGCTTCTTGATGATATTATTGATAAC
TAAGTTCTTGAATTGTCAGGTATGATTACACTTTATTTGATCATTCAAATATGAGTCTAA
ATATCGATTTATTGAATTAAAAAAATAGGTGGTGAATTATAAAGAGTTTGCATTATTTTA
GCTTTAGGTAAGCCTGCTGATGTTTATTTAATCGATGAACCCTCTGCTTACTTGGATTCT
GAATAGAGAATTATTGCTGCTAAAGTTATTAAGAGATATATTTTAAATAGTAAAAAATCT
GCTTTCGTTGTAGAACATGATTTCATTATGGCTACTTATCTTGCTGATAGGTAAATTTTA
TTTACAATCTGAATTTATAAATAGTATTATTTATTTAACAAATTAGTGTCATTGTTTATG
AAGGTACTCCTGGTAAAGAATGTAAGGCTAACAGTCCTCAAAGTTTAGTAAGTGGTATGA
ACAGATTCTTAGAAATTATGGGTGTCACTTTCAGAAGAGACCCTTCAAACTTCAGACCTA
GAATTAATAAAATCGACTCAATTTTGGATAGAGAACAAAAGATTGCTGGTAACTATTTCT
CCTTAGAAGAGTGA