Identifiers and Description

Gene Model Identifier

TTHERM_00112910

Standard Name

RIO2 (RIO2 subfamily protein kinase)

Aliases

PreTt27105 | 8.m00365 | 3812.m02402

Description

RIO2 RIO kinase family protein; serine kinase involved in the processing of the 20S pre-rRNA into mature 18S rRNA

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00112910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03929.19.997093137033517e-262RIO1 family protein (539 aa)
OxytrichaContig1004.1.g801.999787596754473e-118RIO1 family
DictyBaseDDB_G02820995.997605038815675e-110rio2 on chromosome: 3 position
5366397 to 5368196
WormBaseWBGene000136889.99583921019208e-96locus:riok-2 status:Confirme
d UniProt:Q95Q34 protein_i
d:CAC70109.2
SGDYNL207W2.0000012618802033e-84RIO2 Essential serine kinase i
nvolved in the processing of t
he 20S pre-rRNA into mature 18
S rRNA; has similarity to Rio1
p
Stentor CoeruleusSteCoe_224371.368539471173853e-44

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00112910(coding)
ATGGCTAGCTGCTAAAACAAGTATTTAGAATATATGACAAAGGATGAATTCCGTGTCTTG
ACAGCAATTGAAATCGGTATGAGAAATCATGAACTTGTACCTATGCATCTTATAGAAAGA
ATCTCTCATTTAAAGAGAGTATGTGCTAGTAAAGTAGTAAAGTTACTTCTTAAAAATAAG
TTTATTGCACATGAAAATAAAAAATTCGACGGTTATAAATTAACTTACTTGGGATATGAT
TATCTTGCTTTACAGGTTTTTATCAGAAGAGGAGCTATTAAGGAAGTATTAGGAAAAGTA
GGATGTGGTAAAGAGTCAGATATTTATAAATGTGTAAATGAAAATGGAGATTTTGTTATC
TTGAAATTCACTCGTTTGGGCAGAACTTCATTTAGAACAATTAAAAAAAATAGAGATTAT
ATTTAGCATAGAACAAGTTATAGTTGGTTATATTTATCCAGACTTTCTGCTATTAAAGAA
TACACTTTTATGGATCTTCTACATAAGAATAACTTCCCTACACCTATTCCTATTGAGTAA
AATAGACATGGTATTGTTATGAGCTTAATTAATGGTGTTCCTATGCAAAACATTTCTGAA
ATTGACAATCCAAAATATGTTTTTGACTAATGCTTTTATTTGATTAAAAGATTAGCTGAG
AATGGACTTATCCATAGTGATTTTAATGAGTTTAACTTGATGGTAGAAGATAATGGAAAA
GTTATTATGATTGATTTTCCTCAGATGGTTAGCACAAAGCATAAAAATGCATAATTTTAC
TTTGATAGAGATGTTGAATGCATTCACGTTTTCTTTGAAAGAAGATTCAATTACCAGATT
ACTGATACTCTTGATTTCAACAAAATTGCTAGATTAAATGATCTTGATGTATAAGTAAAA
GCTTCTGGATTTATCAAAAAGGAAATAAAGAATATTGATGATTTTGATATTGATTTGAGA
GGTAGTGATGATGATGGCGACGATGATAATAGTGATGATGAAAATGAATAGAATGATTTA
GATAAAAATATAGAATAAGAAGATAGCGATAATGAAATAGAAGAATCTAATAAGAGAATA
CAAAATTTAAATATCTTAAATGATGAAGATATTAGCTAAGATGAAAATGAAGAAGAGCAA
AAAAATAACAAAAAATAAAAAAAGCATCACCTTAAAAAGCAATCAAAATCAAAATCTAAA
AAGTAAAACTAAGAATAAGAAGGAAAAGATGGAGAAGATGATGAAGATAACTAAAAAAAT
AACTTTTCTCCTGATCTTTCTGAAATATCAATAGAAGATTTGAAAGAACTTTAAAAGGTA
AACTAAGATTTATTTTCTGATGATGATAATGAAGATGATCCATTGGCTTTGAATGAGGTT
AAAGATATTAATGGAAATATTGTAGTTCCTGAATAAAAAGAGAAGAAAAAACCTAAAAAG
AAAATGGTAGATATTGCTAATGAATAAGACCAGGATAACAAACAAGACCTAAAAGAAAAA
ATATATATTAAAGAATCAGAATTAGCTGAAAAAGCAAAGGCTTATATTTAAAGATAAGTA
GAAAAGTAATTTAAGTAAAAATATAAAATTCTTAAGAAAAATACAAAAAGCAGTAACAGT
AATAAAGTTTTAGCTTCAGAGTATATGTGA


>TTHERM_00112910(protein)
MASCQNKYLEYMTKDEFRVLTAIEIGMRNHELVPMHLIERISHLKRVCASKVVKLLLKNK
FIAHENKKFDGYKLTYLGYDYLALQVFIRRGAIKEVLGKVGCGKESDIYKCVNENGDFVI
LKFTRLGRTSFRTIKKNRDYIQHRTSYSWLYLSRLSAIKEYTFMDLLHKNNFPTPIPIEQ
NRHGIVMSLINGVPMQNISEIDNPKYVFDQCFYLIKRLAENGLIHSDFNEFNLMVEDNGK
VIMIDFPQMVSTKHKNAQFYFDRDVECIHVFFERRFNYQITDTLDFNKIARLNDLDVQVK
ASGFIKKEIKNIDDFDIDLRGSDDDGDDDNSDDENEQNDLDKNIEQEDSDNEIEESNKRI
QNLNILNDEDISQDENEEEQKNNKKQKKHHLKKQSKSKSKKQNQEQEGKDGEDDEDNQKN
NFSPDLSEISIEDLKELQKVNQDLFSDDDNEDDPLALNEVKDINGNIVVPEQKEKKKPKK
KMVDIANEQDQDNKQDLKEKIYIKESELAEKAKAYIQRQVEKQFKQKYKILKKNTKSSNS
NKVLASEYM


>TTHERM_00112910(gene)
ATGGCTAGCTGCTAAAACAAGGTAAATGATAAAACGATTTAATTGAAAAATAATTTTTTT
AAATCATTTGCTTACTTTAATTACAAAAAGTTTGTAAGTTTGTTAGATAAATATTTTTTT
CTTGATTTTAATTCAGTATGAAAACATTATTTATTTTGATTTAAGTATATTAATAATTTA
TTTGAAAAATATTTAATTTTTAAAATCAAATATGCTTTATTTTGTTTTTGAAAAATTTAA
TGATTAAAATTAATTTAAAAAACAAGTATTAGCGGGATATTTCAAATTTATTTTTTATTT
TATAATTAATTTCCATTTAGATCTAAAAAATATGTGGAAATTAATTGTTTATTAGTCTAA
ATATATTTATCAAACATCAAAATTATAATAAATTAAATTATTAATAATTATAAGCAAAAT
ATAAAAATAGATATTTATTAAATTAAATAAATAGATATAGCAAGCATAAAATGGGAGGAG
ATAATAGCAAGATTATTGGTCAATAAAGGAAAGAGTTATCAGATGGACTGAGAGTTCTAG
AAAATAAAATGAATGATAGATTTAAAACTTTCTCTTCCACACAATAAATTTTAGACCAAA
TACTTAAATCTTAAAGTGACTTATCTAAATAAATGAAATCAATAGACAGCTAAAATAATG
AATTAAAAGTTGAAATCTTAGGTGAGATGTCTAGAATAAGCAATTAATAAGAAAGTCTTA
GCAATAGTTGCATAAAAGATCAGTAAATGGAAGTAGAATTTTCTTCTAAATTAGATATCC
TAAAGGAATCTATTTCTAGAGAATAAGATAATAAACTAGTTAAGAGTTTTGAAGGTCTTC
AGTCGAAGTTGACTTTAGTAGAAAAATAGCTAGACCTTATTAATAATTCATTCAACTAAA
AATGCACAAATCTTGAATAATCTTTATTATCTTAAATTAAAGAAAGCTAAGAGTTGTCAA
ATATCTAAACTACTAAAATGGTTGAGGAGGTTGTTTCTACTCAAATTGAAAAAATTATCA
TCTCTCACTCTCAAAAAATTTCAAAAGTTGAAGAAGACATGGCTAACTAAAAAACTCGTA
TCGATAGTCTCGAATCATCTGTAAAAAATATTTAAGAATCTAGTCAATCTACCAATAAGG
CAATTATCAAATCTATAACTGATTTAGAATAGAAGTTTTCATAAATATCATAAAAATTGG
AAAGCTAAAAAGATAATTTGATTTTAACTACTAAAGATGAGATAAATTAACTTAAAAAAG
AAGTTAACGAATATAAAACTTTAATCTTACGTTTAGAGAAGTAGATAGCATCCTAATAAT
AACAAAATCAAAAACTTATATCTTCTAATACAAGTAAACCTATCTAACAAGATATATCAT
AAGATATAGAAGAGGAATCACCAGCAAAAAAATTCAAGTAACCCTTATCTAAAGATCCTA
TTGATGCTCCAACTCCTAAATCCAAGAAAGAAAAAGACTAAATGGATATTTAGTAAGATA
TAACCACACCTAAATAAAAATAACAAGGCTAATTTAAACAGCAGTTGGCTGAATAATCAT
CTACACCTAAAGAAAAGAAAGATAAAGTCTAATAGTTCGAAATTTAAGAATTTAGCTAGA
AAGCAATCCAAAAGTAAAATGAAAAGGAATAATCTTAAACACTCTAGAAAAGTTAGATCA
AACAAGATAAAACTCCTTAAAATAATTCTGAAATAAAAGTAGATTAAACCCCAAAGTAAA
GCAATCAATCTAAAACAGAAATAACACCTAAGTCATTTGCATAAGAATCAAAGTAAGCCC
TGAAGATAATTAAAAAGGAGTAGCAAATCTAATTAAAAAATGATAATGATGATTATGGAT
CATCTAGCGAAGATGAAGAATCAAGTGAAAGTGAAAATTTACCAAGTAAGAGTAAAATTA
TGTCTAAATAAAATCAAAAAAAGAAGGAATAAAAAACTCCTTAAAGTGATAAAGATTTTA
ATAATTTGAATAAATTGAAAGAGAATACTAAAAATTTCATAAAACAAGAGTAAAATAACA
ACAATAAAGGAGAAAATACTCCTAATTAAAAGAAAAACTTGATTAATAACTAAAATATCA
CAAATAACTAATAAAACTAATAATCTAACTTTAATGGTAAAAATAAATAGAATTTAAAAG
AATAATAGCAAGAATCAACTCCACAAAGCTAGCAGAAGGGTAAAAAAAACTTCAAAAATT
AATATTGATAAATGTATCAGTATGATCTTAAATCTCATTTTAAAATTAGTAGATATACTT
AATAAAACTGTAATAAAATTTTTGATATTGAATTAAGTAAAAATAATTAATCTACAAAAG
TTAAGAGATTTATGTTTTGTTTTCGTTTATAAATAAAAAATGTTTCTTTCTAATTTATAT
ATTCAGTCATTTTTGTGATAGTTTATACAATTTATTACTTATTTTTAATGCTATTTGATT
TTTAATACTATTTCTTTCTAATTTATTAATTTAAAAAAATCAAATTTAATTATGTTTGCT
ATTTGTTCATGTATTTTACAAAAGGCCTAAATTATTATGATTATTATCAAAATTAGTAAT
CCCATGCAAATCAAAATTAAATAAAAAGAATTTGTTATTACCTCAAAATATCAAATATCA
TCAAAAAGTATTGAAAATAATTAAACTATAAATTCACTTCTATTAAATTTAATAAGTAAA
AAGCAAGAAAAAAAAAAAAAAAATGAGATTAGACCCTTCAGTAAAGATTTATATTTAATA
TCAATTTAAGATGTTCAATTCCCATTTTTAAAGTATTTAGAATATATGACAAAGGATGAA
TTCCGTGTCTTGACAGCAATTGAAATCGGTATGAGAAATCATGAAGTAATTTAATTAATT
TGTTATTTCTAAACTGAGTAATAATATTTTTTAATAAAGCTTGTACCTATGCATCTTATA
GAAAGAATCTCTCATTTAAAGAGAGTATGTGCTAGTAAAGTAGTAAAGTTACTTCTTAAA
AATAAGTTTATTGCACATGAAAATAAAAAATGTAAGTTTTAAAAATATTTTTGCTTGATT
AACAAAACTCCTACTTGATTAAATTGAAATTTAAAAACAAATTTATTATAATATGGACAC
TTATTTTAAAAAATCAAAATAGTCGACGGTTATAAATTAACTTACTTGGGATATGATTAT
CTTGCTTTACAGGTACCTATTTAGCTAATCATTTTGAAATTTATTTATCAATAAATATTT
TAATAACAGGTTTTTATCAGAAGAGGAGCTATTAAGGAAGTATTAGGAAAAGTAGGATGT
GGTAAAGAGTCAGATATTTATAAATGTGTAAATGAAAATGGAGATTTTGTTATCTTGAAA
TTCACTCGTTTGGGCAGAACTTCATTTAGAACAATTAAAAAAAATAGAGATTATATTTAG
CATAGAACAAGTTATAGTTGGTTATATTTATCCAGACTTTCTGCTATTAAAGAATACACT
TTTATGGATCTTCTACATAAGGTATTTATTTTAATCAATATTTAGTATTTAGTAAGCTAA
ATTATTAACCATATAAATAGAATAACTTCCCTACACCTATTCCTATTGAGTAAAATAGAC
ATGGTATTGTTATGAGCTTAATTAATGGTGTTCCTATGCAAAACATTTCTGAAATTGACA
ATCCAAAATATGTTTTTGACTAATGCTTTTATTTGATTAAAAGATTAGCTGAGGTAAAGA
AATTATTAATTAATTACGTAAAAAATATTTATATTTATTACTTTAATAAAAAAGAATGGA
CTTATCCATAGTGATTTTAATGAGTTTAACTTGATGGTAGAAGATAATGGAAAAGTTATT
ATGATTGATTTTCCTCAGATGGTTAGCACAAAGCATAAAAATGCATAATTTTACTTTGAT
AGAGATGTTGAATGCATTCACGTTTTCTTTGAAAGAAGATTCAATTACCAGATTACTGAT
ACTCTTGATTTCAACAAAATTGCTAGATTAAATGATCTTGATGTATAAGTAAAAGCTTCT
GGATTTATCAAAAAGGAAATAAAGAATATTGATGATTTTGATATTGATTTGAGAGGTAGT
GATGATGATGGCGACGATGATAATAGTGATGATGAAAATGAATAGAATGATTTAGATAAA
AATATAGAATAAGAAGATAGCGATAATGAAATAGAAGAATCTAATAAGAGAATACAAAAT
TTAAATATCTTAAATGATGAAGATATTAGCTAAGATGAAAATGAAGAAGAGCAAAAAAAT
AACAAAAAATAAAAAAAGCATCACCTTAAAAAGCAATCAAAATCAAAATCTAAAAAGTAA
AACTAAGAATAAGAAGGAAAAGATGGAGAAGATGATGAAGATAACTAAAAAAATAACTTT
TCTCCTGATCTTTCTGAAATATCAATAGAAGATTTGAAAGAACTTTAAAAGGTAAACTAA
GATTTATTTTCTGATGATGATAATGAAGATGATCCATTGGCTTTGAATGAGGTTAAAGAT
ATTAATGGAAATATTGTAGTTCCTGAATAAAAAGAGAAGAAAAAACCTAAAAAGAAAATG
GTAGATATTGCTAATGAATAAGACCAGGATAACAAACAAGACCTAAAAGAAAAAATATAT
ATTAAAGAATCAGAATTAGCTGAAAAAGCAAAGGCTTATATTTAAAGATAAGTAGAAAAG
TAATTTAAGTAAAAATATAAAATTCTTAAGAAAAATACAAAAAGCAGTAACAGTAATAAA
GTTTTAGCTTCAGAGTATATGTGA