Identifiers and Description

Gene Model Identifier

TTHERM_00046680

Standard Name

RIO1 (RIO1 subfamily protein kinase)

Aliases

PreTt11147 | 3.m01919 | 3824.m02908

Description

serine kinase involved in processing of the 20S pre-rRNA i nto mature 18S rRNA

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00046680

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01782.19.997093137033517e-262RIO1 family protein (641 aa)
DictyBaseDDB_G02804316.000220702367707e-121rio1 on chromosome: 3 position
3344181 to 3345988
OxytrichaContig20358.0.g827.001959534329768e-108RIO1 family
WormBaseWBGene000196981.0002646133906571e-103locus:riok-1 Serine/threonin
e-protein kinase RIO1 status
:Confirmed UniProt:O44959
protein_id:CCD67367.1
SGDYOR119C1.0004137340105782e-93RIO1 Essential serine kinase i
nvolved in cell cycle progress
ion and processing of the 20S
pre-rRNA into mature 18S rRNA
Stentor CoeruleusSteCoe_348568.408597124803643e-50

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00046680(coding)
ATGAGTTAGAAAAAGGAAACAAAGCAAAAGAAGATAGTCTTAGTAGATGACTACTTTAAT
CCCACAAAAGAAGATGAGTAAGGAAATAACTAATCAAATAATCCTGAAAATTTGGATGAA
TAGGAATATGATTAACACTCTTCTTCAGATGAGGAATAATATAAAAAAGTTAGCAAAAAA
AAGAAGAATCGTAAAGTAAGTTCAGACGATGACTTAGATGAACTTGACTATTTAGAAGTT
GCAGTGCATAAAGGTAATATAGGTCTTGAAGATGGTCAAGGATTAGCTGTATCAGAAACT
AATGATGCTAAATAAGGTAGACTTGTAGCTAAACTTTCTTCCAAAATTTCTGTTGAGAAA
ATGGGATCTAGAACTACTGCTTCTCATGGAGCTATGCAATCGATTAAAGAAAGCATTAAT
AAATCTTAAAAGGGCTCTAACCGTGTTAAAGATAAGTCTGATCGTGCCACCGTAGAATAG
GTACTTGATCCTCGTACTAGAGTTATCCTTGTTAAATTATTGAATAAGAAGATTATTAAT
GAAATCAATGGCTGTTTATCTACTGGTAAAGAAGCTAACGTTTACCATGCAAGTTCTTCA
AACGGCAAAGAATATGCCATAAAAATTTATAAAACTTCAATCTTAGTATTTAAAGATCGT
GAAAAATACGTTGCTGGTGAATTTCGTTTTAGAAAGGGTCACTGCAAAAGTAATCCACGT
AAAATGATTAAGTTATGGGCTGAAAAAGAAATCCGTAACTTAAAACGTATATATCAAAGT
TCCATCCCTTGTCCTGAACCTTTGATAGTAAAAAGCAATGTTCTTATGATGGAATTCATT
GGTAAAGATGGCAAAGCTGCTCCCCGTCTAAAGGATGCAGAAAATATTGAGTTAGAGCAA
TATTCTAAAATTTATTTACAGTTACTCCGTGATATGAGAACTCTTTATTAAGATTGTAGA
TTAGTTCATGGTGATCTTAGTGAGTACAATTTACTTTATTATAATGAAAAGCTTTACATG
ATTGATGTCTCTCAAAGTATTGAGCACGATCATGCTCATTCACTCGAATTCCTTAGACGT
GATATTGTTAATGTCAATATGTACTTCAAGAAGAAAAATGTTATTACATTTTCTCTTCGT
GATATTTTTGATTTTATCACTGATATCAACATAGTTCCTGGAACTGAAGCAACTATACTT
GAAGAGCTGATTACCAAAGAAAATAAAGACACTGAGCAAGATGAAAAAATTTTTGCTGGA
ATGTACATTCCAAGAACTTTAAATGAAGTTAGTTTTAAGAATATTGAAGCAAACATAGAT
AAGAACATACTGAACGAAGGAAGCGATGAAGAAGCAAAAGATATAGTATATTCAAAACTA
ACAGGACTAATTACAAAAAGCAATAATCAATAAAATTATGAGAGTGAAAGTGATGATGAT
GAAGATGACGACAACGAAGATGAAAACAATAGTGAAGATGATACTGATAAATAGATTGAA
GCAGCAAAACCAAATAAATTTATTAAGATAGTAACTAAAAATGAAGAAGATGGAGGTACT
GAAGAATCAAAATAGAAAGCTTAAGAAGAAGTTTCATAGTTATTAAAATAAATTTAAAGT
AATAAATAAAAATAAGAAGATGATGATTCCTCGTTATCTTCTTCATCTGATAGTGATTCT
GATGATAGTGAAGACAGTGATGAAGATGAAGATGACGAAAATGATAGTGATGATGATGAT
AAATAGTAAGATTCTGAAGAAACTAAAAAAAAGAAAAAAGGAGGAGATTAGCTGTATCAA
GGTCTTTCGAAAGACGAAAGAAAGAAAAAAGTAAAAGAAGAAAAGAAATAAAAAAGAGAA
AATAAAATTCCAAAGCATATCAAAAAATAAATGACTAAAAAAAATAAGAAAAAATGA


>TTHERM_00046680(protein)
MSQKKETKQKKIVLVDDYFNPTKEDEQGNNQSNNPENLDEQEYDQHSSSDEEQYKKVSKK
KKNRKVSSDDDLDELDYLEVAVHKGNIGLEDGQGLAVSETNDAKQGRLVAKLSSKISVEK
MGSRTTASHGAMQSIKESINKSQKGSNRVKDKSDRATVEQVLDPRTRVILVKLLNKKIIN
EINGCLSTGKEANVYHASSSNGKEYAIKIYKTSILVFKDREKYVAGEFRFRKGHCKSNPR
KMIKLWAEKEIRNLKRIYQSSIPCPEPLIVKSNVLMMEFIGKDGKAAPRLKDAENIELEQ
YSKIYLQLLRDMRTLYQDCRLVHGDLSEYNLLYYNEKLYMIDVSQSIEHDHAHSLEFLRR
DIVNVNMYFKKKNVITFSLRDIFDFITDINIVPGTEATILEELITKENKDTEQDEKIFAG
MYIPRTLNEVSFKNIEANIDKNILNEGSDEEAKDIVYSKLTGLITKSNNQQNYESESDDD
EDDDNEDENNSEDDTDKQIEAAKPNKFIKIVTKNEEDGGTEESKQKAQEEVSQLLKQIQS
NKQKQEDDDSSLSSSSDSDSDDSEDSDEDEDDENDSDDDDKQQDSEETKKKKKGGDQLYQ
GLSKDERKKKVKEEKKQKRENKIPKHIKKQMTKKNKKK


>TTHERM_00046680(gene)
ATGAGTTAGAAAAAGGAAACAAAGCAAAAGAAGATAGTCTTAGTAGATGACTACTTTAAT
CCCACAAAAGAAGATGAGTAAGGAAATAACTAATCAAATAATCCTGAAAATTTGGATGAA
TAGGAATATGATTAACACTCTTCTTCAGATGAGGAATAATATAAAAAAGTTAGCAAAAAA
AAGAAGAATCGTAAAGTAAGTTCAGACGATGACTTAGATGAACTTGACTATTTAGAAGTT
GCAGTGCATAAAGGTAATATAGGTCTTGAAGATGGTCAAGGATTAGCTGTATCAGAAACT
AATGATGCTAAATAAGGTAGACTTGTAGCTAAACTTTCTTCCAAAATTTCTGTTGAGAAA
ATGGGATCTAGAACTACTGCTTCTCATGGAGCTATGCAATCGATTAAAGAAAGCATTAAT
AAATCTTAAAAGGGCTCTAACCGTGTTAAAGATAAGTCTGATCGTGCCACCGTAGAATAG
GTACTTGATCCTCGTACTAGAGTTATCCTTGTTAAATTATTGAATAAGAAGATTATTAAT
GAAATCAATGGCTGTTTATCTACTGGTAAAGAAGCTAACGTTTACCATGCAAGTTCTTCA
AACGGCAAAGAATATGCCATAAAAATTTATAAAACTTCAATCTTAGTATTTAAAGATCGT
GAAAAATACGTTGCTGGTGAATTTCGTTTTAGAAAGGGTCACTGCAAAAGTAATCCACGT
AAAATGATTAAGTTATGGGCTGAAAAAGAAATCCGTAACTTAAAACGTATATATCAAAGT
TCCATCCCTTGTCCTGAACCTTTGATAGTAAAAAGCAATGTTCTTATGATGGAATTCATT
GGTAAAGATGGCAAAGCTGCTCCCCGTCTAAAGGATGCAGAAAATATTGAGTTAGAGCAA
TATTCTAAAATTTATTTACAGTTACTCCGTGATATGAGAACTCTTTATTAAGATTGTAGA
TTAGTTCATGGTGATCTTAGTGAGTACAATTTACTTTATTATAATGAAAAGCTTTACATG
ATTGATGTCTCTCAAAGTATTGAGCACGATCATGCTCATTCACTCGAATTCCTTAGACGT
GATATTGTTAATGTCAATATGTACTTCAAGAAGAAAAATGTTATTACATTTTCTCTTCGT
GATATTTTTGATTTTATCACTGATATCAACATAGTTCCTGGAACTGAAGCAACTATACTT
GAAGAGCTGATTACCAAAGAAAATAAAGACACTGAGCAAGATGAAAAAATTTTTGCTGGA
ATGTACATTCCAAGAACTTTAAATGAAGTTAGTTTTAAGAATATTGAAGCAAACATAGAT
AAGAACATACTGAACGAAGGAAGCGATGAAGAAGCAAAAGATATAGTATATTCAAAACTA
ACAGGACTAATTACAAAAAGCAATAATCAATAAAATTATGAGAGTGAAAGTGATGATGAT
GAAGATGACGACAACGAAGATGAAAACAATAGTGAAGATGATACTGATAAATAGATTGAA
GCAGCAAAACCAAATAAATTTATTAAGATAGTAACTAAAAATGAAGAAGATGGAGGTACT
GAAGAATCAAAATAGAAAGCTTAAGAAGAAGTTTCATAGTTATTAAAATAAATTTAAAGT
AATAAATAAAAATAAGAAGATGATGATTCCTCGTTATCTTCTTCATCTGATAGTGATTCT
GATGATAGTGAAGACAGTGATGAAGATGAAGATGACGAAAATGATAGTGATGATGATGAT
AAATAGTAAGATTCTGAAGAAACTAAAAAAAAGAAAAAAGGAGGAGATTAGCTGTATCAA
GGTCTTTCGAAAGACGAAAGAAAGAAAAAAGTAAAAGAAGAAAAGAAATAAAAAAGAGAA
AATAAAATTCCAAAGCATATCAAAAAATAAATGACTAAAAAAAATAAGAAAAAATGA